
Text extracted from the exhibit documents filed with the FCC. Open a document above to read the original.
Question? Contact Philips Question? Contact Philips BT3080 6SHFLÀFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH *LEVRQ,QQRYDWLRQV/LPLWHG$OOULJKWVUHVHUYHG 7KLVSURGXFWKDVEHHQPDQXIDFWXUHGE\DQGLVVROGXQGHUWKHUHVSRQVLELOLW\RI*LEVRQ ,QQRYDWLRQV/WGDQG*LEVRQ,QQRYDWLRQV/WGLVWKHZDUUDQWRULQUHODWLRQWRWKLVSURGXFW 3KLOLSVDQGWKH3KLOLSV6KLHOG(PEOHPDUHUHJLVWHUHGWUDGHPDUNVRI.RQLQNOLMNH3KLOLSV19 DQGDUHXVHGXQGHUOLFHQVHIURP.RQLQNOLMNH3KLOLSV19 %7BB6KRUW8VHU0DQXDOB9 (1Short User Manual (6Manual de usuario corto )5Bref mode d’emploi Always there to help you Register your product and get support at ZZZSKLOLSVFRPVXSSRUW (1 ,PSRUWDQW 6DIHW\ :DUQLQJ •Never remove the casing of this speaker. •Never lubricate any part of this speaker. •Never place this speaker on other electrical equipment. •.HHSWKLVVSHDNHUDZD\IURPGLUHFWVXQOLJKWQDNHGÁDPHVRUKHDW ,PSRUWDQWVDIHW\LQVWUXFWLRQV a5HDGWKHVHLQVWUXFWLRQV b.HHSWKHVHLQVWUXFWLRQV c+HHGDOOZDUQLQJV d)ROORZDOOLQVWUXFWLRQV e'RQRWXVHWKLVDSSDUDWXVQHDUZDWHU f&OHDQRQO\ZLWKGU\FORWK g'RQRWEORFNDQ\YHQWLODWLRQRSHQLQJV,QVWDOOLQDFFRUGDQFH ZLWKWKHPDQXIDFWXUHU·VLQVWUXFWLRQV h'RQRWLQVWDOOQHDUDQ\KHDWVRXUFHVVXFKDVUDGLDWRUVKHDW UHJLVWHUVVWRYHVRURWKHUDSSDUDWXV LQFOXGLQJDPSOLÀHUV WKDWSURGXFHKHDW i3URWHFWWKHSRZHUFRUGIURPEHLQJZDONHGRQRUSLQFKHG SDUWLFXODUO\DWSOXJVFRQYHQLHQFHUHFHSWDFOHVDQGWKHSRLQW ZKHUHWKH\H[LWIURPWKHDSSDUDWXV j2QO\XVHDWWDFKPHQWVDFFHVVRULHVVSHFLÀHGE\WKH PDQXIDFWXUHU k8QSOXJWKLVDSSDUDWXVGXULQJOLJKWQLQJVWRUPVRUZKHQ XQXVHGIRUORQJSHULRGVRIWLPH l5HIHUDOOVHUYLFLQJWRTXDOLÀHGVHUYLFHSHUVRQQHO6HUYLFLQJLV UHTXLUHGZKHQWKHDSSDUDWXVKDVEHHQGDPDJHGLQDQ\ZD\ VXFKDVOLTXLGKDVEHHQVSLOOHGRUREMHFWVKDYHIDOOHQLQWR WKHDSSDUDWXVWKHDSSDUDWXVKDVEHHQH[SRVHGWRUDLQRU PRLVWXUHGRHVQRWRSHUDWHQRUPDOO\RUKDVEHHQGURSSHG m%DWWHU\VKDOOQRWEHH[SRVHGWRH[FHVVLYHKHDWVXFKDV VXQVKLQHÀUHRUWKHOLNH n$SSDUDWXVVKDOOQRWEHH[SRVHGWRGULSSLQJRUVSODVKLQJ o'RQRWSODFHDQ\VRXUFHVRIGDQJHURQWKHDSSDUDWXV HJ OLTXLGÀOOHGREMHFWVOLJKWHGFDQGOHV p:KHUHWKHSOXJRIWKH'LUHFW3OXJLQ$GDSWHULVXVHGDV WKHGLVFRQQHFWGHYLFHWKHGLVFRQQHFWGHYLFHVKDOOUHPDLQ UHDGLO\RSHUDEOH 1RWH •The type plate is located on the bottom of the apparatus. 1RWLFH $Q\FKDQJHVRUPRGLÀFDWLRQVPDGHWRWKLVGHYLFHWKDWDUHQRW expressly approved by Gibson Innovations may void the user’s authority to operate the equipment. 1RWLFHIRUWKH86$DQG&DQDGD This device complies with Part 15 of the FCC Rules and license- exempt RSS standard of Industry Canada. Operation is subject to the following two conditions: this device may not cause harmful interference, and this device must accept any interference received, including interference that may cause undesired operation. 7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWKWKH OLPLWVIRUD&ODVV%GLJLWDOGHYLFHSXUVXDQWWRSDUWRIWKH)&& 5XOHVThese limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses, and can radiate radio frequency energy and, if not installed and used in accordance with the instruction manual, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: •Relocate the receiving antenna. •Increase the separation between equipment and receiver. •Connect the equipment into an outlet on a circuit different from that to which the receiver is connected. •Consult the dealer or an experienced radio/TV technician for help. 5)5DGLDWLRQ([SRVXUH6WDWHPHQWThis equipment complies with FCC’s and IC’s RF radiation exposure limits set forth for an uncontrolled environment. The antenna(s) used for this transmitter must be installed and operated to provide a separation distance of at least 20 cm from all persons and must not be collocated or operating in conjunction with any other antenna or transmitter. Installers must ensure that 20cm separation distance will be maintained between the device (excluding its handset) and users. &$1,&(6 % 10% % 'LVSRVDORI\RXUROGSURGXFWDQGEDWWHU\ Your product is designed and manufactured with high quality materials and components, which can be recycled and reused. This product may contain lead and mercury. Disposal of these materials may be regulated due to environmental considerations. For disposal or recycling information, please contact your local authorities or visit www.recycle.philips.com. This product contains non-removable batteries: •Do not incinerate. Batteries may explode if overheated. •For disposal or recycling information, please contact your local authorities or visit www.recycle.philips.com. &DXWLRQ •Removal of the built-in battery invalidates the warranty and may destroy the product. P&F USA, Inc. PO Box 2248, Alpharetta, GA 30023-2248 Register online at www.philips.com/welcome today to get the very most from your purchase. For Customer Use Enter below the Serial No. which is locat- ed on the rear of the cabinet. Retain this information for future reference. Model No.__________________________ Serial No.________________________ This “bolt of lightning” indicates unin- sulated material within your unit may cause an electrical shock. For the safety of everyone in your household, please do not remove product covering. The “exclamation point” calls atten- tion to features for which you should read the enclosed literature closely to pre- vent operating and maintenance problems. WARNING:To reduce the risk of fire or electric s…
Text truncated - open the document above for the full version.
-------------------------------------------------------------------------------- (FCC ID:2AANUBT3080) POWER OF ATTORNEY DATE: 201 5-05-19 Federal Communications Commission Authorization and Evaluation Division 7435 Oakland Mills Road Columbia, MD 21046 To Whom It May Concern: We, the undersigned, hereby authorize Shenzhen SEM.Test Technology Co., Ltd. Jandy So on our behalf, to apply to the Federal Communications Commission on our equipment. Any and all acts carried out by Shenzhen SEM.Test Technology Co., Ltd. Jandy So on our behalf shall have the same effect as acts of our own. This is to advise that we are in full compliance with the Anti-Drug Abuse Act. We, Gibson Innovations Limited are not subject to a denial of federal benefits pursuant to Section 5301 of the Anti-Drug Act of 1988, 21 USC853a, and no party to the application is subject to a denial of federal benefits pursuant to that section. Sincerely, GIBSON INNOVATIONS LIMITED ------------------------- (Benson Lai) (Manager)
--------------------------------------------------------------------------------------------------------------------- Federal Communications Commission Authorizat ion and Evaluation Divisio n Confidentiality Request regarding application for certification of FCC ID: 2AANUBT3080 Pursuant to Sections 0.457 and 0.459 of the Commission’s Rules, we hereby request confidential treatment of information accompanying this application as outlined below: Exhibit Type File Name Schematics 2AANUBT3080_FCCID_Schematics Block Diagram 2AANUBT3080_FCCID_BlockDiagram Operational Description 2AANUBT3080_FCCID_OperationalDescription The above materials contain trade secrets and proprietary information not customarily released to the public. The public disclosure of these materials may be harmful to the applicant and provide unjustified benefits to its competitors. The applicant understands that pursuant to Section 0.457 of the Rules, disclosure of this application and all accompanying documentation will not be made before the date of the Grant for this application. Sincerely, GIBSON INNOVATIONS LIMITED ------------------------- (Benson Lai) (Manager)
GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 EXHIBIT 2 - EUT EXTERNAL PHOTOGRAPHS EUT View 1 EUT View 2 GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 EUT View 3 EUT View 4 GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 EUT View 5 EUT View 6 GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 EUT View 7
GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 EXHIBIT 1 - PRODUCT LABELING Proposed FCC ID Label Format FCC ID: 2AANUBT3080 This device complies with Part 15 of the FCC Rules. Operation is subject to the following two conditions: (1) This device may not cause harmful interference, and (2) this device must accept any interference received, including interference that may cause undesired operation. Specifications: Text is Black in color and justified. Labels are printed in indelible ink on permanent adhesive silk-screened onto the EUT or shall be affixed at a conspicuous location on the EUT. Proposed Label Location on EUT FCC ID Label Location
GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 EXHIBIT 1 - PRODUCT LABELING Proposed FCC ID Label Format FCC ID: 2AANUBT3080 This device complies with Part 15 of the FCC Rules. Operation is subject to the following two conditions: (1) This device may not cause harmful interference, and (2) this device must accept any interference received, including interference that may cause undesired operation. Specifications: Text is Black in color and justified. Labels are printed in indelible ink on permanent adhesive silk-screened onto the EUT or shall be affixed at a conspicuous location on the EUT. Proposed Label Location on EUT FCC ID Label Location
GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 EXHIBIT 3 - EUT INTERNAL PHOTOGRAPHS EUT Housing and Board View 1 EUT Housing and Board View 2 GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 EUT Housing and Board View 3 Solder Board-Component View 1 BT Antenna GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 Solder Board-Component View 2 Solder Board-Component View 3 GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 Solder Board-Component View 4 Solder Board-Component View 5 GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 Solder Board-Component View 6 Solder Board-Component View 7 GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 Solder Board-Component View 8 Solder Board-Component View 9 GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 Solder Board-Component View 10 Solder Board-Component View 11 GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 Solder Board-Component View 12 Solder Board-Component View 13
RF Exposure Requirements Product Description: Bluetooth Portable Speaker Model No.: BT3080X/37 FCC ID: 2AANUBT3080 According to the KDB 447498 D01 V05r02, the following RF exposure evaluation shall to demonstrate RF exposure compliance. Bluetooth Tx frequency range: 2402~2480MHz Device category: Portable device (Distance: 5mm) Maximum Conducted Output Power: -2.859dBm Maximum Conducted Output Power: 0.5177mW Limit: 10mW Source-based time-averaged Conducted output power is 0.5177mW < 10mW So the transmitter complies with the RF exposure requirements and the SAR is not required.
GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I PAGE 1 OF 52 FCC PART 15.247 FCC Part 15C Measurement and Test Report For GIBSON INNOVATIONS LIMITED 5/F Philips Electronics Building, 5 Science Park East Ave, HK Science Park Shatin, NT, Hong Kong FCC ID: 2AANUBT3080 FCC Rule(s): FCC Part 15.247 Product Description: Wireless Portable Speaker Tested Model: BT3080X/37 Report No.: STRD1504097I Tested Date: 2015-05-06 to 2015-05-08 Issued Date: 2015-05-09 Tested By: Vigoss Liang / Engineer Reviewed By: Lahm Peng / EMC Manager Approved & Authorized By: Jandy so / PSQ Manager Prepared By: Shenzhen SEM.Test Technology Co., Ltd. 1/F, Building A, Hongwei Industrial Park, Liuxian 2nd Road, Bao'an District, Shenzhen, P.R.C.(518101) Tel.: +86-755-33663308 Fax.: +86-755-33663309 Website: www.semtest.com.cn Note: This test report is limited to the above client company and the product model only. It may not be duplicated without prior permitted by Shenzhen SEM.Test Technology Co., Ltd. GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I PAGE 2 OF 52 FCC PART 15.247 TABLE OF CONTENTS 1. GENERAL INFORMATION ................................................................................................................................... 4 1.1 PRODUCT DESCRIPTION FOR EQUIPMENT UNDER TEST (EUT) ............................................................................... 4 1.2 TEST STANDARDS ................................................................................................................................................... 5 1.3 TEST METHODOLOGY ............................................................................................................................................. 5 1.4 TEST FACILITY ....................................................................................................................................................... 5 1.5 EUT SETUP AND TEST MODE ................................................................................................................................. 6 2. SUMMARY OF TEST RESULTS ........................................................................................................................... 7 3. RF EXPOSURE ......................................................................................................................................................... 8 3.1 STANDARD APPLICABLE ......................................................................................................................................... 8 3.2 TEST RESULT.......................................................................................................................................................... 8 4. ANTENNA REQUIREMENT .................................................................................................................................. 9 4.1 STANDARD APPLICABLE ......................................................................................................................................... 9 4.2 EVALUATION INFORMATION .................................................................................................................................. 9 5. FREQUENCY HOPPING SYSTEM REQUIREMENTS ................................................................................... 10 5.1 STANDARD APPLICABLE ....................................................................................................................................... 10 5.2 FREQUENCY HOPPING SYSTEM............................................................................................................................. 10 5.3 EUT PSEUDORANDOM FREQUENCY HOPPING SEQUENCE .................................................................................... 11 6. QUANTITY OF HOPPING CHANNELS AND CHANNEL SEPARATION ................................................... 12 6.1 STANDARD APPLICABLE ....................................................................................................................................... 12 6.2 TEST EQUIPMENT LIST AND DETAILS ................................................................................................................... 12 6.3 TEST PROCEDURE ................................................................................................................................................. 12 6.4 ENVIRONMENTAL CONDITIONS ............................................................................................................................ 12 6.5 SUMMARY OF TEST RESULTS/PLOTS .................................................................................................................... 13 7. DWELL TIME OF HOPPING CHANNEL .......................................................................................................... 17 7.1 STANDARD APPLICABLE ....................................................................................................................................... 17 7.2 TEST EQUIPMENT LIST AND DETAILS ................................................................................................................... 17 7.3 TEST PROCEDURE ................................................................................................................................................. 17 7.4 ENVIRONMENTAL CONDITIONS ............................................................................................................................ 17 7.5 SUMMARY OF TEST RESULTS/PLOTS .................................................................................................................... 18 8. 20DB BANDWIDTH ............................................................................................................................................... 28 8.1 STANDARD APPLICABLE ....................................................................................................................................... 28 8.2 TEST EQUIPMENT…
Text truncated - open the document above for the full version.
GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 EXHIBIT 4 - TEST SETUP PHOTOGRAPHS Conducted Emission Test Setup Radiation Emission Test Setup (Below 30MHz) GIBSON INNOVATIONS LIMITED Model: BT3080X/37 REPORT NO.: STRD1504097I FCC PART 15.247 Radiation Emission Test Setup (30MHz to 1GHz) Radiation Emission Test Setup (Above 1GHz)
| # | Rule Parts | Frequency Range | Power Output |
|---|---|---|---|
| 1 | 15C | 2.40 GHz - 2.48 GHz | 500.00 µW |

Bluetooth Headphones
Equipment Class
DSS - Part 15 Spread Spectrum Transmitter
Bluetooth Headphones
Equipment Class
DSS - Part 15 Spread Spectrum Transmitter
Bluetooth Headphones
Equipment Class
DSS - Part 15 Spread Spectrum Transmitter
Bluetooth Headphones
Equipment Class
DTS - Digital Transmission System
Bluetooth Headphones
Equipment Class
DTS - Digital Transmission System