TQ8-AN340DHANDIGITAL CAR AVN SYSTEM

 *HQHUDO :DUQLQJVDQG&DXWLRQV .H\3URGXFW)HDWXUHV &RPSRQHQW1DPHVDQG)XQFWLRQV 8VLQJWKH6\VWHPIRUWKH)LUVW7LPH  AN340DHAN AN341DHAN AN340DHKN  :DUQLQJVDQG&DXWLRQV 6DIHW\:DUQLQJV 'XGPYJGPTGEGKXKPITQWVGIWKFCPEGHTQOVJG0CXKICVKQPU[UVGO RNGCUGCDKFGD[CEVWCNVTCHHKECPFTQCFTGIWNCVKQPU(QNNQYKPIQPN[VJG 0CXKICVKQPTQWVGIWKFCPEGOC[NGCFVQXKQNCVKQPUQHCEVWCNVTCHHKECPF TQCFTGIWNCVKQPUCPFNGCFVQVTCHHKECEEKFGPVU  9JGPEJGEMKPIVJGEWTTGPVXGJKENGUCRGGFHKTUVEJGEMVJGURGGFQO GVGTTCVJGTVJCPVJGURGGFFKURNC[GFYKVJKPVJG0CXKICVKQP &QPQVUVCTGCVVJGUETGGPYJKNGFTKXKPI5VCTKPICVVJGUETGGPHQTRTQ NQPIGFRGTKQFUQHVKOGEQWNFNGCFVQVTCHHKECEEKFGPVU &QPQVQRGTCVGVJG0CXKICVKQPU[UVGOYJKNGFTKXKPIUWEJCUGPVGTKPI 21+UQTEQPFWEVKPITQWVGUGCTEJGU5WEJCEVUEQWNFNGCFVQCEEKFGPVU 2CTMVJGXGJKENGDGHQTGQRGTCVKPIVJGFGXKEG &QPQVFKUCUUGODNGCUUGODNGQTOQFKH[VJG#80U[UVGO5WEJCEVU EQWNFTGUWNVKPCEEKFGPVUHKTGQTGNGEVTKEUJQEM 7UKPIRJQPGHGCVWTGUYJKNGFTKXKPIOC[FKUVTCEVFTKXGTUHTQORC[KPICVVGPVKQPVQ VTCHHKEEQPFKVKQPUCPFTGUWNVKPVTCHHKECEEKFGPVU7UGRJQPGHGCVWTGUQPN[CHVGT VJGXGJKENGJCUDGGPRCTMGF *GGFECWVKQPPQVVQURKNNYCVGTQTKPVTQFWEGHQTGKIPQDLGEVUKPVQVJGFGXKEG5WEJ CEVUEQWNFNGCFVQUOQMGHKTGQTRTQFWEVOCNHWPEVKQP 2NGCUGTGHTCKPHTQOWUGKHVJGUETGGPKUDNCPMQTPQUQWPFECPDGJGCTFCU VJGUGUKIPUOC[KPFKECVGRTQFWEVOCNHWPEVKQP%QPVKPWGFWUGKPUWEJEQPFKVKQPU EQWNFNGCFVQCEEKFGPVU HKTGUGNGEVTKEUJQEM QTRTQFWEVOCNHWPEVKQPU &QPQVVQWEJVJGCPVGPPCFWTKPIVJWPFGTQTNKIJVPKPICUUWEJCEVUOC[NGCFVQ NKIJVPKPIKPFWEGFGNGEVTKEUJQEM &QPQVUVQRQTRCTMKPRCTMKPITGUVTKEVGFCTGCUVQQRGTCVGVJGRTQFWEV5WEJ CEVUEQWNFNGCFVQVTCHHKECEEKFGPVU 6JGXKFGQUETGGPYKNNPQVQRGTCVGYJGPVJGXGJKENGKUKPOQVKQP(QT[QWTUCHGV[ HKTUVRCTMVJGXGJKENGVQYCVEJQTXKGYVJGUETGGP 5QOG0QPXKFGQHGCVWTGUOC[CNUQPQVQRGTCVGYJGPVJGXGJKENGKUKPOQVKQP 6JGUGHGCVWTGUYKNNQRGTCVGQPN[YJGPVJGXGJKENGJCUDGGPRCTMGF :DUQLQJVDQG&DXWLRQV :DUQLQJVDQG&DXWLRQVO 6DIHW\&DXWLRQV +PUQOGKPUVCPEGUVJGPCXKICVKQPOC[RTQXKFGIWKFCPEGVJTQWIJTGUVTKEVGFCTGCU 1RGTCVKPIVJGFGXKEGYJKNGFTKXKPIEQWNFNGCFVQCEEKFGPVUFWGVQCNCEMQHCVVGP VKQPVQGZVGTPCNUWTTQWPFKPIU(KTUVRCTMVJGXGJKENGDGHQTGQRGTCVKPIVJGFGXKEG +PCFFKVKQPUQOGHGCVWTGUOC[PQVYQTMHQT[QWTUCHGV[YJGPVJGXGJKENGKUKP OQVKQP6JGUGHGCVWTGUYKNNQRGTCVGQPN[YJGPVJGXGJKENGJCUDGGPRCTMGF #FLWUVVJGXQNWOGVQNGXGNUVJCVCNNQYVJGFTKXGTVQJGCTUQWPFUHTQOQWVUKFGQH VJGXGJKENG&TKXKPIKPCUVCVGYJGTGGZVGTPCNUQWPFUECPPQVDGJGCTFOC[NGCFVQ CEEKFGPVU 2C[CVVGPVKQPVQVJGXQNWOGUGVVKPIYJGPVWTPKPIVJGFGXKEGQP#UWFFGPQWVRWV QHGZVTGOGXQNWOGWRQPVWTPKPIVJGFGXKEGQPEQWNFNGCFVQJGCTKPIKORCKTOGPV #FLWUVVJGXQNWOGVQCUWKVCDNGNGXGNUDGHQTGVWTPKPIQHHVJGFGXKEG +H[QWYCPVVQEJCPIGVJGRQUKVKQPQHFGXKEGKPUVCNNCVKQPRNGCUGKPSWKTGYKVJ[QWT RNCEGQHRWTEJCUGQTUGTXKEGOCKPVGPCPEGEGPVGT6GEJPKECNGZRGTVKUGKUTGSWKTGF VQKPUVCNNQTFKUCUUGODNGVJGFGXKEG  6WTPQPVJGECTKIPKVKQPDGHQTGWUKPIVJKUFGXKEG&QPQVQRGTCVGVJG#WFKQ8KFGQ 0CXKICVKQPU[UVGOHQTNQPIRGTKQFUQHVKOGYKVJVJGKIPKVKQPVWTPGFQHHCUUWEJ QRGTCVKQPUOC[NGCFVQDCVVGT[FKUEJCTIG 7RQPWUKPIVJG#WFKQ8KFGQ0CXKICVKQPU[UVGOHQTOQTGVJCPOKPWVGUYKVJVJG ECTGPIKPGVWTPGFQHHVJGHQNNQYKPIYCTPKPIYKNNDGFKURNC[GFő$CVVGT[&KUEJCTIG 9CTPKPIŒ#HVGTOKPWVGUVJGYCTPKPIYKNNDGFKURNC[GFHQTUGEQPFUGXGT[ OKPWVG  &QPQVUWDLGEVVJGFGXKEGVQUGXGTGUJQEMQTKORCEV&KTGEVRTGUUWTGQPVQVJG HTQPVUKFGQHVJGOQPKVQTOC[ECWUGFCOCIGVQVJG.%&QTVQWEJUETGGP  9JGPENGCPKPIVJGFGXKEGOCMGUWTGVQVWTPQHHVJGFGXKEGCPFWUGCFT[CPF UOQQVJENQVJ  0GXGTWUGVQWIJOCVGTKCNUEJGOKECNENQVJUQTUQNXGPVU CNEQJQNDGP\GPGVJKP PGTUGVE CUUWEJOCVGTKCNUOC[FCOCIGVJGFGXKEGRCPGNQTECWUGEQNQTSWCNKV[ FGVGTKQTCVKQP  9JGPGZRGTKGPEKPIRTQFWEVOCNHWPEVKQPUKPSWKTGYKVJ[QWTRNCEGQHRWTEJCUGQT UGTXKEGOCKPVGPCPEGEGPVGT  .H\3URGXFW)HDWXUHV 6JKUFGXKEGKUCPCNNKPQPG&TKXGT+PHQTOCVKQP5[UVGOGSWKRRGFYKVJCOWNVKHWPEVKQPCN&8&RNC[GT0CXKICVKQP$NWGVQQVJ s *CPFUHTGGCPFXCTKQWUQVJGTHGCVWTGU 6JG9+&'8)#.%&RTQXKFGUCJKIJSWCNKV[TGUQNWVKQPVQDQVJFTKXGTCPFRCUUGPIGTUYJKNGVJGRQYGTHWNCPFTKEJUQWPFU[UVGOCFFUVQFTKXKPIGPLQ[OGPV 9KFG6(6.%&&KURNC[2TQXKFGUJKIJSWCNKV[XKFGQVJTQWIJC9KFG6(6.%&&KURNC[WUKPICP.'&$CEM.KIJV 5WRRQTVHQTXCTKQWU/GFKC(QTOCVU 5WRRQTVHQTXCTKQWUOGFKCHQTOCVUKPENWFKPI(/#/4CFKQ#WFKQ/28KFGQ%&&8&#7: 5WRRQTVU75$K2QFCPF$NWGVQQVJ s #WFKQ5VTGCOKPIOQFGU ,WMGDQZ5WRRQTVUEQR[CPFRNC[QHOWUKEXKFGQKOCIGUVQTGFYKVJKP75$KPVQ,WMGDQZ KPVGTPCNOGOQT[ OQFG /CZ)$  )TCEGPQVG 9JGPRNC[KPIOWUKECWVQOCVKECNN[TGEGKXGUFGVCKNGFOWUKEKPHQTOCVKQPUWEJCUUQPIPCOGCTVKUVCNDWOCPFIGPTG CPFFKURNC[UQPVJGUETGGP #WFKQ%&75$,WMGDQZOQFGUUWRRQTVGF  8QKEG)WKFCPEG 8QKEGTQWVGIWKFCPEGVQUCHGN[CPFEQPXGPKGPVN[TGCEJUGVFGUVKPCVKQPU 8CTKQWUOCRUECNGUVJCVGPCDNGUFTKXGTUVQCEEWTCVGN[XKGYOCRCPFUWTTQWPFKPICTGCU $NWGVQQVJ s *CPFUHTGG%QPXGPKGPVWUGQH$NWGVQQVJ s *CPFUHTGGD[WUKPIDWVVQPUYKVJKPVJGUVGGTKPITGOQVGEQPVTQNNGT (TQPV%GPVTCN%QPVTQNNGTFKTGEVKQPCNLQIFKCNEQPVTQNNGTUHQTEQPXGPKGPVEQPVTQNCPFCEEGUUVQXCTKQWUU[UVGOHGCVWTGU &RPSRQHQW1DPHVDQG)XQFWLRQV &RPSRQHQW1DPHVDQG)XQFWLRQVO &RPSRQHQW1DPHVDQG)XQFWLRQV +HDG8QLW 0Q 0COG&GVCKNU &+5%+0.'&&KURNC[UVJG&+5%KPUGTVUVCVG &+5%176&+5%GLGEVMG[ &+5%+PUGTV 5NQV &+5%KPUGTVGLGEVUNQV &+526WTPUQHHVJGUETGGPQTFKURNC[UVJGENQEMFGHCWNVKOCIG 2QYGT81. 7UGFVQVWTPFGXKEGRQYGT101((CPFEQPVTQNXQN WOG9JGPRQYGTKUQHHRTGUUVQVWTPRQYGTQP 9JGPRQYGTKUQPRTGUUCPFJQNF QXGTUGEQPFU  VQVWTPRQYGTQHH …

Text truncated - open the document above for the full version.

Hyundai MOBIS Co., Ltd. #679-4, Yeoksam-dong, Gangnam-gu, Seoul, 135-977, Korea Tel. 82-31-288-5232 / Fax. 82-31-280-2764 16 January 2013 Federal Communications Commission 7435 Oakland Mills Road Columbia MD 21046 To whom it may concern: I, the undersigned, hereby authorize Lab Manager Feel Jeong of SGS Korea Co., Ltd.(hereafter referred to as SGS Korea) to act on our behalf in all manners relating to application for equipment authorization, including signing of all documents relating to these matters. Any and all acts carried out by Lab Manager Feel Jeong of SGS Korea Co., Ltd.on our behalf shall have the same effect as acts of our own. I, the undersigned, hereby certify that we are not subject to a denial of federal benefits, that includes FCC benefits, pursuant to Section 5301 of the Anti-Drug Abuse Act of 1988, 21 U.S.C. 853(a). In authorizing SGS Korea as our agent, we still recognize that we are responsible to: a)comply with the relevant provisions of the certification program; b)make all necessary arrangements for the conduct of the evaluation, including provision for examining documentation and access to all areas, records (including internal audit reports) and personnel for the purposes of evaluation (e.g. testing, inspection, assessment, surveillance, reassessment) and resolution of complaints; c)make claims regarding certification only in respect of the scope for which certification has been granted; d)do not use our product certification in such a manner as to bring the Certification Division into disrepute and not make any statement regarding our product certification which the Certification Division may consider misleading or unauthorized; e)upon suspension or cancellation of certification, discontinue use of all advertising matter that contains any reference thereto and return any certification documents as required by the Certification Division; f)usecertification only to indicate the products are certified as being in conformity specified standards; g)endeavor to ensure that no certificate or report nor any part thereof is used in a manner; h)ensure that any reference to our product certif documents, brochures or advertising, complies with the requirements of Division; i)keep a record of all complaints made known to the us relating to the product’s with requirements of the rel Certification Division when requested; j)take appropriate action with respect to such complaints and any deficiencies products or services that affect compliance with the requirements for k)document the actions taken. This authorization is valid until further written notice from the applicant. Sincerely Yours, __________________________ Jongtae Kim Senior Manager Hyundai MOBIS Co., Ltd. Hyundai MOBIS Co., Ltd. #679-4, Yeoksam-dong, Gangnam-gu, Seoul, 135 Tel. 82-31-288-5232/ Fax. 82 certification only to indicate the products are certified as being in conformity endeavor to ensure that no certificate or report nor any part thereof is used in a ensure that any reference to our product certification in communication media documents, brochures or advertising, complies with the requirements of keep a record of all complaints made known to the us relating to the product’s with requirements of the relevant standard and to make these records Certification Division when requested; take appropriate action with respect to such complaints and any deficiencies products or services that affect compliance with the requirements forcertification; document the actions taken. This authorization is valid until further written notice from the applicant. Hyundai MOBIS Co., Ltd. gu, Seoul, 135-977, Korea / Fax. 82-31-280-2764 certification only to indicate the products are certified as being in conformitywith endeavor to ensure that no certificate or report nor any part thereof is used in amisleading ication in communication mediasuch as documents, brochures or advertising, complies with the requirements ofthe Certification keep a record of all complaints made known to the us relating to the product’scompliance evant standard and to make these recordsavailable to take appropriate action with respect to such complaints and any deficienciesfound in certification;

Hyundai MOBIS Co., Ltd. #679‐4, Yeoksam‐dong, Gangnam‐gu, Seoul, 135‐977, Korea Tel. 82‐31‐288‐5232 / Fax. 82‐31‐280‐2764 26 July 2013 Federal Communications Commission Authorization and Evaluation Division 7435 Oakland Mills Road, Columbia, MD 21046 Request of Confidentiality for FCC ID: TQ8‐AN340DHAN To Whom It May Concern: Pursuant to Sections 0.457 and 0.459 of the Commission’s Rules (CFR 47), and Section 552 (b) (4) of the Freedom of Information Act, Hyundai MOBIS Co., Ltd. hereby requests confidentiality and treatment of certain information accompanying this application. The materials contain trade secrets and proprietary information not customarily released to the public. The public disclosure of these matters might be harmful to the Applicant and provide unjustified benefits to its competitors. We are also hereby request Short‐Term Confidentiality for 180 days after the grant as outlined in Public Notice DA 04‐1705. This provision will give Hyundai MOBIS Co., Ltd. temporary confidentiality of commercially sensitive information prior to product release. The requested Permanent and Temporary Confidential exhibits are listed as follows: CONFIDENTIAL LIST Permanent 1 Block Diagram 2 Operational Descriptions 3 Schematics Short‐Term 4 External Photos 5 Internal Photos 6 Test‐Setup Photos 7 User’s Manual The Applicant understands that pursuant to Rule 0.457, disclosure of this application and all accompanying documentations, where applicable, will not be made public before the date of the Grant for this application. Sincerely, __________________________ Jongtae Kim Senior Manager Hyundai MOBIS Co., Ltd.

Model :AN340DHAN External photos of EUT Model :AN340DHAN Front view of EUT Rear view of EUT Model :AN340DHAN Top view of EUT Bottom view of EUT Model :AN340DHAN Side view of EUT

Hyundai MOBIS Co., Ltd. FCC MODEL:AN340DHAN FCC ID:TQ8-AN340DHAN LABEL LOCATION AN340DHAN FCC LABEL Information FCC ID:TQ8-AN340DHAN Nonremovable LABEL This device complies with part 15 of the FCC rules and industry Canada license-exempt RSS standard(s). Operation is subject to the following two conditions: (1) This device may not cause harmful interference, and (2) This device must accept any interference received, including interference that may cause undesired operation. Made in Korea MANUFACTURED BY HYUNDAI MOBIS PRODUCT LABEL FRONT TOP Hyundai MOBIS Co., Ltd.

Model :AN340DHAN Internal photos of EUT Model :AN340DHAN Top view of EUT Model :AN340DHAN Top view of Main PCB Bottom view of Main PCB Model :AN340DHAN Top view of Sub PCB-1 Bottom view of Sub PCB-1 Model :AN340DHAN Top view of Sub PCB-2 Bottom view of Sub PCB-2 Model :AN340DHAN Top view of Sub PCB-3 Bottom view of Sub PCB-3 Model :AN340DHAN Top view of Sub PCB-4 Bottom view of Sub PCB-4 Model :AN340DHAN Top view of Sub PCB-5 Bottom view of Sub PCB-5 Model :AN340DHAN Top view of LCD Bottom view of LCD Model :AN340DHAN Top view of Module Bottom view of Module & Antenna Module & Antenna

Report Number :F690501/RF-RTL006787Page:2of5 The results shown in this test report refer only to the sample(s) tested unless otherwise stated. This test report cannot be reproduced, except in full, without prior written permission of the Company. SGS Korea Co., Ltd. (Gunpo Laboratory)18-34, Sanbon-dong, Gunpo-si, Gyeonggi-do, Korea, 435-040 Tel. +82 31 428 5700 / Fax. +82 31 427 2371www.ee.sgs.com/korea INDEX Table of ContentsPage 1. General Information --------------------------------------------------------------------------------3 2. RF Exposure Evaluation --------------------------------------------------------------------------4 Report Number :F690501/RF-RTL006787Page:3of5 The results shown in this test report refer only to the sample(s) tested unless otherwise stated. This test report cannot be reproduced, except in full, without prior written permission of the Company. SGS Korea Co., Ltd. (Gunpo Laboratory)18-34, Sanbon-dong, Gunpo-si, Gyeonggi-do, Korea, 435-040 Tel. +82 31 428 5700 / Fax. +82 31 427 2371www.ee.sgs.com/korea 1. General Information 1.1. Testing Laboratory SGS Korea Co., Ltd. (Gunpo Laboratory) - Wireless Div. 3FL, 18-34, Sanbon-dong, Gunpo-si, Gyeonggi-do, Korea 435-040 (Lab) - 400-2, Gomae-Dong, Giheung-Gu, Yongin-Si, Gyeonggi-Do, South Korea. (Chamber) All SGS services are rendered in accordance with the applicable SGS conditions of service available on request and accessible athttp://www.sgs.com/en/Terms-and-Conditions.aspx. Telephone:+82 31 428 5700 FAX:+82 31 427 2371 1.2. Details of Applicant Applicant:Hyundai MOBIS Co., Ltd. Address:80-9, Mabook-Dong, Giheung-Gu, Yongin-Shi, Gyunggi-Do, 446-912, South Korea Contact Person:Kim, Jong-Tae Phone No.:+82 31 260 0092 1.3. Description of EUT Kind of Product DIGITAL CAN AVN SYSTEM Model Name FCC: AN340DHAN (Alt. : AN341DHAN) IC: AN340DHKN Serial Number N/A Power Supply DC 14.4 V (Lead-acid battery power source used on vehicles) Frequency Range 2 402㎒~ 2 480㎒ Modulation Technique GFSK, π/4DQPSK, 8DPSK Number of Channels 79 Antenna Type Chip antenna Antenna Gain 1.0㏈i 1.4. Test report revision RevisionReport numberDescription 0F690501/RF-RTL006787Initial 1.5. Alternative models Model nameInformation AN340DHAN - Basic model - Model for North America, Not interlocked with UVO AN341DHAN - Same to basic model but it is different below function - Moder for North America, Interlocked with UVO AN340DHKN - Same to basic model but it is different below function - Moder for Canada Report Number :F690501/RF-RTL006787Page:4of5 The results shown in this test report refer only to the sample(s) tested unless otherwise stated. This test report cannot be reproduced, except in full, without prior written permission of the Company. SGS Korea Co., Ltd. (Gunpo Laboratory)18-34, Sanbon-dong, Gunpo-si, Gyeonggi-do, Korea, 435-040 Tel. +82 31 428 5700 / Fax. +82 31 427 2371www.ee.sgs.com/korea 2. RF Exposure Evaluation 2.1. Environmental evaluation and exposure limit according to FCC CFR 47 part 1, 1.1307(b), 1.1310 According to FCC 1.1310 : The criteria listed in the following table shall be used to evaluate the environment impact of human exposure to radio frequency (RF) radiation as specified in §1.1307(b) LIMITS FOR MAXIMUM PERMISSIBLE EXPOSURE (MPE) 2.1.1. Friis transmission formula: Pd = (Pout*G)/(4*pi*R 2 ) Where Pd = power density in㎽/㎠ Pout = output power to antenna in㎽ G = gain of antenna in linear scale Pi = 3.1416 R = distance between observation point and center of the radiator in㎝ Pd the limit of MPE, 1㎽/㎠. If we know the maximum gain of the antenna and the total power input to the antenna, through the calculation, we will know the distance where the MPE limit is reached. Frequency Range (㎒) Electric Field Strength(V/m) Magnetic Field Strength (A/m) Power Density (㎽/㎠) Average Time (A) Limits for Occupational /Control Exposures 300 – 1 500----F/3006 1 500 – 100 000----56 (B) Limits for General Population/Uncontrol Exposures 300 – 1 500----F/15006 1 500 – 100 000----130 Report Number :F690501/RF-RTL006787Page:5of5 The results shown in this test report refer only to the sample(s) tested unless otherwise stated. This test report cannot be reproduced, except in full, without prior written permission of the Company. SGS Korea Co., Ltd. (Gunpo Laboratory)18-34, Sanbon-dong, Gunpo-si, Gyeonggi-do, Korea, 435-040 Tel. +82 31 428 5700 / Fax. +82 31 427 2371www.ee.sgs.com/korea 2.1.2. Test Result of RF Exposure Evaluation Test Item：RF Exposure Evaluation Data Test Mode：Normal Operation 2.1.3.Output Power into Antenna & RF Exposure Evaluation Distance FHSS: GFSK Channel Channel Frequency (㎒) Output Average Power to Antenna (㏈m) Antenna Gain (㏈i) Duty Cycle (%) Power Density at 20㎝ (㎽/㎠) Power Density at 20㎝ (Ｗ/㎡) Limits (㎽/㎠) Low2 4021.851.0460.000 180.001 761 Middle2 4411.231.0460.000 150.001 531 High2 4801.331.0460.000 160.001 561 FHSS: π/4DQPSK Channel Channel Frequency (㎒) Output Average Power to Antenna (㏈m) Antenna Gain (㏈i) Duty Cycle (%) Power Density at 20㎝ (㎽/㎠) Power Density at 20㎝ (Ｗ/㎡) Limits (㎽/㎠) Low2 4021.141.0460.000 150.001 501 Middle2 4410.441.0460.000 130.001 271 High2 4800.381.0460.000 130.001 261 FHSS: 8DPSK Channel Channel Frequency (㎒) Output Average Power to Antenna (㏈m) Antenna Gain (㏈i) Duty Cycle (%) Power Density at 20㎝ (㎽/㎠) Power Density at 20㎝ (Ｗ/㎡) Limits (㎽/㎠) Low2 4021.181.0460.000 150.001 511 Middle2 4410.511.0460.000 130.001 301 High2 4800.411.0460.000 130.001 271 Note : 1. The power density Pd (5th column) at a distance of 20㎝calculated from the friis transmission formula is far below the limit of 1㎽/㎠.

Report Number:F690501/RF-RTL006786Page:2of65 The results shown in this test report refer only to the sample(s) tested unless otherwise stated. This test report cannot be reproduced, except in full, without prior written permission of the Company. SGSKoreaCo.,Ltd.(GunpoLaboratory) 18-34, Sanbon-dong, Gunpo-si, Gyeonggi-do, Korea, 435-040 Tel. +82 31 428 5700 / Fax. +82 31 427 2371www.ee.sgs.com/korea INDEX Table of ContentsPage 1. General Information ---------------------------------------------------------------------------------3 2. Transmitter Radiated Spurious Emissions and Conducted Spurious Emission ------7 3. 20㏈Bandwidth and 99% BW ------------------------------------------------------------------ 31 4. Maximum Peak Output Power -------------------------------------------------------------------42 5. Hopping Channel Separation ---------------------------------------------------------------------44 6. Number of Hopping Frequency ------------------------------------------------------------------47 7. Time of Occupancy(Dwell Time) -----------------------------------------------------------------51 8. Antenna Requirement ------------------------------------------------------------------------------65 Report Number:F690501/RF-RTL006786Page:3of65 The results shown in this test report refer only to the sample(s) tested unless otherwise stated. This test report cannot be reproduced, except in full, without prior written permission of the Company. SGSKoreaCo.,Ltd.(GunpoLaboratory) 18-34, Sanbon-dong, Gunpo-si, Gyeonggi-do, Korea, 435-040 Tel. +82 31 428 5700 / Fax. +82 31 427 2371www.ee.sgs.com/korea 1. General Information 1.1. Testing Laboratory SGS Korea Co., Ltd. (Gunpo Laboratory) - Wireless Div. 3FL, 18-34, Sanbon-dong, Gunpo-si, Gyeonggi-do, Korea 435-040 (Lab) - 400-2, Gomae-Dong, Giheung-Gu, Yongin-Si, Gyeonggi-Do, South Korea. (Chamber) All SGS services are rendered in accordance with the applicable SGS conditions of service available on request and accessible athttp://www.sgs.com/en/Terms-and-Conditions.aspx. Telephone:+82 31 428 5700 FAX:+82 31 427 2371 1.2. Details of Applicant Applicant:Hyundai MOBIS Co., Ltd. Address:80-9, Mabook-Dong, Giheung-Gu Yongin-Shi, Gyunggi-Do, 446-912, South Korea Contact Person:Kim, Jong-Tae Phone No.:+82 31 260 0092 1.3. Description of EUT Kind of Product DIGITAL CAN AVN SYSTEM Model Name FCC: AN340DHAN (Alt. : AN341DHAN) IC: AN340DHKN Serial Number N/A Power Supply DC 14.4 V (Lead-acid battery power source used on vehicles) Frequency Range 2 402㎒~ 2 480㎒ Modulation Technique GFSK, π/4DQPSK, 8DPSK Number of Channels 79 Antenna Type Chip antenna Antenna Gain 1.0㏈i 1.4. Declaration by the manufacturer - Adaptive Frequency Hopping is supported and use at least 20 channels Report Number:F690501/RF-RTL006786Page:4of65 The results shown in this test report refer only to the sample(s) tested unless otherwise stated. This test report cannot be reproduced, except in full, without prior written permission of the Company. SGSKoreaCo.,Ltd.(GunpoLaboratory) 18-34, Sanbon-dong, Gunpo-si, Gyeonggi-do, Korea, 435-040 Tel. +82 31 428 5700 / Fax. +82 31 427 2371www.ee.sgs.com/korea 1.5. Information about the FHSS characteristics: 1.5.1. Pseudorandom Frequency Hopping Sequence The channel is represented by a pseudo-random hopping sequence hopping through the 79 RF channels. The hopping sequence is unique for the piconet and is determined by the Bluetooth device address of the master; the phase in the hopping sequence is determined by the Bluetooth clock of the master. The channel is divided into time slots where each slot corresponds to an RF hop frequency. Consecutive hops correspond to different RF hop frequencies. The nominal hop rate is 1 600 hops/s. 1.5.2. Equal Hopping Frequency Use All Bluetooth units participating in the piconet are time and hop-synchronized to the channel. 1.5.3. Example of a 79 hopping sequence in data mode: 40, 21, 44, 23, 42, 53, 46, 55, 48, 33, 52, 35, 50, 65, 54, 67, 56, 37, 60, 39, 58, 69, 62, 71, 64, 25, 68, 27, 66, 57, 70, 59, 72, 29, 76, 31, 74, 61, 78, 63, 01, 41, 05, 43, 03, 73, 07, 75, 09, 45, 13, 47, 11, 77, 15, 00, 64, 49, 66, 53, 68, 02, 70, 06, 01, 51, 03, 55, 05, 04 1.5.4. System Receiver Input Bandwidth Each channel bandwidth is 1㎒ 1.5.5. Equipment Description 15.247(a)(1) that the rx input bandwidths shift frequencies in synchronization with the transmitted 15.247(g): In accordance with the Bluetooth Industry Standard, the system is designed to comply with all of the regulations in Section 15.247 when the transmitter is presented with a continuous data (or information) system. 15.247(h): In accordance with the Bluetooth Industry Standard, the system does not coordinate it channels selection/ hopping sequence with other frequency hopping systems for the express purpose of avoiding the simultaneous occupancy of individual hopping frequencies by multiple transmitters. 1.6. Alternative models Model nameInformation AN340DHAN - Basic model - Model for North America, Not interlocked with UVO AN341DHAN - Same to basic model but it is different below function - Moder for North America, Interlocked with UVO AN340DHKN - Same to basic model but it is different below function - Moder for Canada Report Number:F690501/RF-RTL006786Page:5of65 The results shown in this test report refer only to the sample(s) tested unless otherwise stated. This test report cannot be reproduced, except in full, without prior written permission of the Company. SGSKoreaCo.,Ltd.(GunpoLaboratory) 18-34, Sanbon-dong, Gunpo-si, Gyeonggi-do, Korea, 435-040 Tel. +82 31 428 5700 / Fax. +82 31 427 2371www.ee.sgs.com/korea 1.7. Test Equipment List EquipmentManufacturerModelS/NCal DateCal IntervalCal Due. Signal GeneratorR&S SMR40100272 Aug. 23, 2012AnnualAug. 23, 2013 Spectrum AnalyzerR&SFSL6100639Jun. 26, 2013AnnualJun. 26, 2014 Spectrum AnalyzerAgilentN9030AUS51350132Oct. 30, 2012AnnualOct. 30, 2013 Bluetooth TesterTESOMTC-3000C3000C000142Dec. 24, 2012 Annual Dec. 2…

Text truncated - open the document above for the full version.

Model :AN340DHAN Test setup photo of EUT Model :AN340DHAN Photo of radiated spurious emission Model :AN340DHAN