HDCTRC4203Fixed Point to Point Spread Spectrum Transceiver

75$&(58VHU0DQXDO75$$ TRACER II 4203 8VHU0DQXDO 75$$75$&(58VHU0DQXDO 75$&(58VHU0DQXDOL 5 $',2 ) 5(48(1&< , 17(5)$&( 6 7$7(0(17 7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRRPSO\ZLWKWKHOLPLWVIRUDQLQWHQWLRQDOUDGLDWRUSXUVXDQW WR3DUW6XESDUW&RIWKH)&&5XOHV7KLVHTXLSPHQWJHQHUDWHVXVHVDQGDQUDGLDWHUDGLRIUHTXHQ\ HQHUJ\,IQRWLQVWDOOHGDQGXVHGLQDRUGDQHZLWKWKHLQVWUXWLRQVLWPD\DXVHLQWHUIHUHQHWRUDGLR RPPXQLDWLRQV 7KHOLPLWVDUHGHVLJQHGWRSURYLGHUHDVRQDEOHSURWHWLRQDJDLQVWVXKLQWHUIHUHQHLQDUHVLGHQWLDOVLWX DWLRQ+RZHYHUWKHUHLVQRJXDUDQWHHWKDWLQWHUIHUHQHZLOOQRWRXULQDSDUWLXODULQVWDOODWLRQ,IWKLV HTXLSPHQWGRHVDXVHLQWHUIHUHQHWRUDGLRRUWHOHYLVLRQUHHSWLRQZKLKDQEHGHWHUPLQHGE\WXUQLQJ WKHHTXLSPHQWRQDQGRIIWKHXVHULVHQRXUDJHGWRWU\WRRUUHWWKHLQWHUIHUHQHE\RQHRUPRUHRIWKH IROORZLQJPHDVXUHV ‡ 5HRULHQWRUUHORDWHWKHUHHLYLQJDQWHQQDRIWKHDIIHWHGUDGLRRUWHOHYLVLRQ ‡ ,QUHDVHWKHVHSDUDWLRQEHWZHHQWKHHTXLSPHQWDQGWKHDIIHWHGUHHLYHU ‡ &RQQHWWKHHTXLSPHQWDQGWKHDIIHWHGUHHLYHUWRSRZHURXWOHWVRQVHSDUDWHLUXLWV ‡ &RQVXOWWKHGHDOHURUDQH[SHULHQHGUDGLR79WHKQLLDQIRUKHOS 6KLHOGHG&DEOHV $VKLHOGHGW\SHSRZHURUGLVUHTXLUHGLQRUGHUWRPHHW)&&HPLVVLRQOLPLWVDQGDOVRWRSUHYHQWLQWHU IHUHQHZLWKQHDUE\UDGLRDQGWHOHYLVLRQUHHSWLRQZKHQXVLQJWKH$&YROWDJHDGDSWHU,WLVHVVHQWLDO WKDWRQO\WKH$GWUDQSURYLGHGSRZHURUGEHXVHG )&&2XWSXW3RZHU5HVWULWLRQV 7KH)&&GRHVQRWUHTXLUHOLHQVLQJWRLPSOHPHQWWKLVGHYLH+RZHYHUWKH)&&KDVHVWDEOLVKHGUHVWUL WLRQVUHJDUGLQJPD[LPXPRXWSXWSRZHUDQGWKHDGMXVWPHQWVUHTXLUHGZKHQHPSOR\LQJGLUHWLRQDOJDLQ DQWHQQDV,5HIHUWR
6HWWLQJWKH7UDQVPLWWHU3RZHU
LQ6HWLRQRIWKLVPDQXDO.7KHVHUHVWULWLRQVDUH GHWDLOHGLQ)&&3DUW,E.,.,E.,.,L.DQG,.,LLL.,WLVWKHUHVSRQVLELOLW\RIWKHLQGLYLGXDOVGH VLJQLQJDQGLPSOHPHQWLQJWKHUDGLRV\VWHPWRDVVXUHRPSOLDQHZLWKWKHVHDQGDQ\RWKHUSHUWLQHQW)&& 5XOHVDQG5HJXODWLRQV7KLVGHYLHPXVWEHSURIHVVLRQDOO\LQVWDOOHG ([SRVXUHWR5DGLR)UHTXHQ\)LHOGV 7KH75$&(5LVGHVLJQHGLQWKUHHYHUVLRQVZLWKWKHIROORZLQJSRZHURSWLRQV *+]#P: *+]#: *+]#P: :$51,1* &KDQJHVRUPRGLILDWLRQVQRWH[SUHVVO\DSSURYHGE\$'75$1RXOGYRLGWKHXVHU¶VDXWKRULW\WR RSHUDWHWKHHTXLSPHQW 75$$ 5DGLR)UHTXHQ \,QWHUIHUHQ H6WDWHPHQW LL75$&(58VHU0DQXDO 7KHVHOHYHOVRI5)HQHUJ\LQDUHEHORZWKH0D[LPXP3HUPLVVLEOH([SRVXUH,03(.OHYHOVVSHLILHGLQ )&&2(77KHLQVWDOODWLRQRIKLJKJDLQDQWHQQDHTXLSPHQWLQWKHV\VWHPRQILJXUDWLRQPD\ UHDWHWKHRSSRUWXQLW\IRUH[SRVXUHWROHYHOVKLJKHUWKDQUHRPPHQGHGIRUWKHJHQHUDOSRSXODWLRQDWD GLVWDQHOHVVWKDQ16.5IHHW,5PHWHUs)IURPWKHHQ WHURIWKH DQWHQ QD7KHIRO ORZLQJSUHDXWLRQVPXVW EHWDNHQGXULQJLQVWDOODWLRQRIWKLVHTXLSPHQW ‡ 7KHLQVWDOOHGDQWHQQDPXVWQRWEHORDWHGLQDPDQQHUWKDWDOORZVH[SRVXUHRIWKHJHQHUDOSRSXOD WLRQWRWKHGLUHWEHDPSDWKRIWKHDQWHQQDDWDGLVWDQHOHVVWKDQ16.5IHHW,5 PHWHUV.,QVWDOODWLRQ  RQWRZHUVPDVWVRUURRIWRSVQRWDHVVLEOHWRWKHJHQHUDOSRSXODWLRQLVUHRPPHQGHGRU ‡0RXQ WWKHDQWHQQDLQDPDQQHUWKDWSUH YHQWVDQ\SHUVRQQHOIURPHQWHULQJ WKHDUHDZLWKLQ16.5IHHW ,5PHWHUs)IURPWKHIURQWRIWKHDQWHQQ D ‡ ,WLVUHRPPHQGHGWKDWWKHLQVWDOOHUSODHUDGLRIUHTXHQ\KD]DUGZDUQLQJVVLJQVRQWKHEDUULHUWKDW SUHYHQWVDHVVWRWKHDQWHQQD ‡ 3ULRUWRLQVWDOOLQJWKHDQWHQQDWRWKH5)&RXWSXWPDNHVXUHWKHSRZHULVDGMXVWHGWRWKHVHWWLQJV VSHLILHGLQ6HWLRQRIWKLVPDQXDO ‡ 'XULQJDQWHQQDLQVWDOODWLRQEHVXUHWKDWSRZHUWRWKH75$&(5HTXLSPHQWLVWXUQHGRIILQRUGHUWR SUHYHQWDQ\HQHUJ\SUHVHQHRQWKHRD[LDORQQHWRU ‡ 'XULQJLQVWDOODWLRQDQGDOLJQPHQWRIWKHDQWHQQDGRQRWVWDQGLQIURQWRIWKHDQWHQQDDVVHPEO\ ‡ 'XULQJLQVWDOODWLRQDQGDOLJQPHQWRIWKHDQWHQQDGRQRWKDQGOHRUWRXKWKHIURQWRIWKHDQWHQQD 7KHVHVLPSOHSUHDXWLRQVPXVWEHWDNHQWRSUHYHQWJHQHUDOSRSXODWLRQDQGLQVWDOODWLRQSHUVRQQHOIURP H[SRVXUHWR5)HQHUJ\LQH[HVVRIVSHLILHG03(OHYHOV 75$$ 7DEOHRI&RQWHQWV 75$&(58VHU0DQXDOLLL 3DJH 6H WLRQ75$&(5'HV ULSWLRQ Introduction................................................................................................................................1 ISM Band Spread Spectrum ......................................................................................................1 Applications...............................................................................................................................1 Spread Spectrum........................................................................................................................2 Direct Sequence .............................................................................................................2 Coding............................................................................................................................2 Channel Selection ......................................................................................................................2 Forward Error Correction ..........................................................................................................3 T1 Operation..................................................................................................................3 Framing..............................................................................................................3 Line Code...........................................................................................................3 DS1/DSX-1 Interface.........................................................................................3 Line Buildout or LBO........................................................................................3 TRACER 4103 System C…

Text truncated - open the document above for the full version.

Revised Block Diagram 280 MHz TX IF 5747 MHz 5827 MHz 5747 MHz 5827 MHz 140 MHz RX IF

American Telecommunications Certification Body Inc. 6731 Whittier Ave, McLean, VA 22101 January 25, 2002 RE: Adtran, Inc FCC ID: HDCTRC4203 Comments are addressed by WLL in Blue/Bold and reference supporting documents where applicable. 1.) Please provide processing gain test results for this equipment. See exhibit "Tracer Processing Gain.pdf" 2.) Form 731 should show the maximum measured conducted power. See exhibit "Revised 731 Form.pdf" 3.) Form 731 shows frequency range of 5747 to 5827 MHz. This is at odds with the listed specifications in the Manual. Specifications in the Manual have been corrected. See 5.) 4.) Please provide RF Exposure information. See exhibit "MPE Report.pdf" 5.) Please add co-location prohibitions to the manual. See exhibit "Revised Manual.pdf" 6.) Please provide additional internal photos of the PA module. See exhibit "Internal Module Photos.pdf" 7.) Block diagram provided is only for the baseband side of this device. Please provide additional block diagram of the transmit and PA portion of this equipment. See exhibit "Revised Block Diagram.pdf" Processing will continue upon receipt of these materials.. William H. Graff President and Examining Engineer mailto: [email protected] The items indicated above must be submitted before processing can continue on the above referenced application. Failure to provide the requested information may result in application termination. Correspondence should be considered part of the permanent submission and may be viewed from the Internet after a Grant of Equipment Authorization is issued. Please do not respond to this correspondence using the email reply button. In order for your response to be processed expeditiously, you must submit your documents through the AmericanTCB.com website. Also, please note that partial responses increase processing time and should not be submitted. Any questions about the content of this correspondence should be directed to the sender.

American Telecommunications Certification Body Inc. 6731 Whittier Ave, McLean, VA 22101 January 25, 2002 RE: Adtran, Inc FCC ID: HDCTRC4203 I have a few comments on this Application. 1.) Please provide processing gain test results for this equipment under 15.247(e). 2.) Form 731 should show the maximum measured conducted power. Please correct. 3.) Form 731 shows frequency range of 5747 to 5827 MHz. This is at odds with the listed specifications in the Manual. Please address. 4.) Please provide RF Exposure information. Be sure to use maximum measured power in the evaluation and list all antennas by type and/or model number to be utilized with this equipment. 5.) Please add co-location prohibitions to the manual. 6.) Please provide additional internal photos of the PA module. With covers removed. 7.) Block diagram provided is only for the baseband side of this device. Please provide additional block diagram of the transmit and PA portion of this equipment. Processing will continue upon receipt of these materials.. William H. Graff President and Examining Engineer mailto: [email protected] The items indicated above must be submitted before processing can continue on the above referenced application. Failure to provide the requested information may result in application termination. Correspondence should be considered part of the permanent submission and may be viewed from the Internet after a Grant of Equipment Authorization is issued. Please do not respond to this correspondence using the email reply button. In order for your response to be processed expeditiously, you must submit your documents through the AmericanTCB.com website. Also, please note that partial responses increase processing time and should not be submitted. Any questions about the content of this correspondence should be directed to the sender.

ColpQrare Office 901 Explorer Blvd. Huntsvil1c, AL 35806 u.s Mail P.Q. B\)x 140000 Huntsville, At 35814-4000 Toll F~e: 1 800 9ADTRAN Tclcphone: 256.963.8000 hnp:llwww .adtran.cOrn Date: October 5, 200 1 American Telecommunications Certification Body, Inc. 6731 WhittierAvenue SuitCIIO McLean, V A 22101 RE: FCC ID: Certification Application HDCTRC4203 To Whom It May Concern: Please be advised that the foJlowing infonnation is to be held confidential on behalf of ADTRAN Inc. for the Tracer II 4203 product: Schematjcs Theory of operation The application contains technjcal infonnation which ADTRAN, Inc. deems to be trade secrets and proprietary .If made public, tbe infonnation might be used to the disadvantage of the applicant in the market place. Thank you for yoW" attention in this matter. Signatory .Whitmire ~anager, Regulatory Compliance ADTRAN, Inc. 901 Explorer Blvd. Huntsville. AL 35806

External View Top and Front External View Rear External View Bottom

2.125” +/- .020” 1.00” +/- .020” .100” RAD. DATEREV ECO# COMMENT 2/9/01 @AN/A ORIGINAL REV PRODUCT DRAWN BYENGINEERAPPROVED BY A. BREMERJ. REYNOLDS TITLE SCALEDWG. NO. TRACER 4203, 5.8 MHz 32895980 LABLE, FCC 1.00” 1:1 901 EXPLORER BVD. P.O. BOX 140000 HUNTSVILLE, AL 35814-4000 10/4/01 @BN/A RE-LAYOUT LABEL FOR COMPLIANCE INFO NOTES: 1. PRINT PER ARTWORK SUPPLIED. 2. MATERIAL: .002 WHITE MYLAR SUBSTRATE BLACK LETTERING, .001 CLEAR MYLAR OVERLAY LAMINATED, FLEXCON L-344 OR UL APPROVED EQUAL PRESSURE SENSITIVE ADHESIVE BACKSIDE. 3. FONT: HELVETICA & ERAS DEMI, NO FONT SUBSTITUTIONS PERMITTED. 4. FILM: EMULSION SIDE UP. FCC ID: HDCTRC4203 TRACER 4203 This equipment complies with part 15 of FCC rules. Operation is subject to the following two conditions: (1) This device may not cause harmful interference, and (2) This device must accept any interference received, including interference that may cause undesired operation. 1280TRC582T1R1A COMPLIES WITH PART 68, FCC RULES RINGER EQUIVALENCE: N/A FCC REG: US: HDCDENAN1280TRCT1

Tracer II 4203 FCC Label Location FCC Label Location

Front View Back View Bottom View Open 1 Open 2

Top Cover Removed Power Amplifier Module Top View Power Amplifier Module Bottom View Processor Control Board Top View Processor Control Board Bottom View RF Converter Board Top View RF Converter Board Bottom View RF Converter Shields Removed

Document 6794-01, Rev. 0 FCC Certification Test Report Washington Laboratories, Ltd October 2001 FCC Certification Test Report for ADTRAN, Inc. Direct Sequence Spread Spectrum Transceiver FCC ID: HDCTRC4203 October 16, 2001 Prepared for: ADTRAN, Inc. 901 Explorer Blvd Huntsville, AL 35806 Prepared By: Washington Laboratories, Ltd. 7560 Lindbergh Drive Gaithersburg, Maryland 20879 FCC Certification Test Report Document 6794-01, Rev. 0 FCC Certification Test Report Washington Laboratories, Ltd October 2001 FCC Certification Test Report for the ADTRAN, Inc. TRACER 4203 Direct Sequence Spread Spectrum Transceiver WLL JOB# 6794 Prepared by: Michael F. Violette President Reviewed by: Greg Snyder Chief EMC Engineer Document 6794-01, Rev. 0 FCC ID: HDCTRC4203 FCC Certification Test Report Washington Laboratories, Ltd October 2001 ii Abstract This report has been prepared on behalf of ADTRAN, Inc. to support the attached Application for Equipment Authorization. The test report and application are submitted for a Spread Spectrum Transceiver under Part 15.247 of the FCC Rules and Regulations. This Federal Communication Commission (FCC) Certification Test Report documents the test configuration and test results for an ADTRAN, Inc. TRACER 4203 Direct Sequence Spread Spectrum Transceiver. Testing was performed on an Open Area Test Site (OATS) of Washington Laboratories, Ltd, 7560 Lindbergh Drive, Gaithersburg, MD 20879. Site description and site attenuation data have been placed on file with the FCC's Sampling and Measurements Branch at the FCC laboratory in Columbia, MD. Washington Laboratories, Ltd. has been accepted by the FCC and approved by NIST NVLAP (NVLAP Lab Code: 200066-0) as an independent FCC test laboratory. The ADTRAN, Inc. TRACER 4203 Spread Spectrum Transceiver complies with the limits for a Spread Spectrum Transceiver device under Part 15.247 of the FCC Rules and Regulations. Document 6794-01, Rev. 0 FCC ID: HDCTRC4203 FCC Certification Test Report Washington Laboratories, Ltd October 2001 iii Table of Contents Abstract......................................................................................................ii 1 Introduction...................................................................................................................1 1.1 Compliance Statement............................................................................................1 1.2 Test Scope............................................................................................................1 1.3 Contract Information..............................................................................................1 1.4 Test Dates.............................................................................................................1 1.5 Test and Support Personnel....................................................................................1 1.6 Abbreviations.........................................................................................................2 2 Equipment Under Test....................................................................................................3 2.1 EUT Identification & Description............................................................................3 2.2 Test Configuration..................................................................................................4 2.3 Testing Algorithm...................................................................................................4 2.4 Test Location.........................................................................................................4 2.5 Measurements........................................................................................................5 2.5.1 References.........................................................................................................5 2.6 Measurement Uncertainty.......................................................................................5 3 Test Results...................................................................................................................6 3.1 Peak Power Output...............................................................................................6 3.2 Power Spectral Density..........................................................................................6 3.3 Occupied Bandwidth..............................................................................................6 3.4 Spurious Emissions at Antenna Terminals (FCC Part §15.247(b))...........................9 3.5 Radiated Spurious Emissions: (FCC Part §15.247(c))...........................................16 3.5.1 Test Procedure..............................................................................................16 4 Test Equipment............................................................................................................19 Document 6794-01, Rev. 0 FCC ID: HDCTRC4203 FCC Certification Test Report Washington Laboratories, Ltd October 2001 iv List of Tables Table 1. Device Summary....................................................................................................3 Table 2. Oscillators..............................................................................................................4 Table 3. Power Spectral Density..........................................................................................6 Table 4. Occupied Bandwidth Results..................................................................................9 Table 5: Radiated Emission Test Data-Dish Antenna—Channel A.......................................17 Table 6: Radiated Emission Test Data-Dish Antenna—Channel B.......................................18 Table 7: Test Equipment List..............................................................................................19 List of Figures Figure 1. Occupied Bandwidth Channel A...........................................................................…

Text truncated - open the document above for the full version.

Measurement and Evaluation of Tracer Processing Gain Prepared By: Matthew Kliesner Adtran, Inc. 901 Explorer Blvd. P.O. Box 140000 Huntsville, AL 35814-4000 June 14, 2000 Page 3 Measurement and Evaluation on Tracer Processing Gain Measurement and Evaluation of Tracer Processing Gain To comply with FCC Regulations part 15.247(e), a direct-sequence spread spectrum system must have a processing gain of at least 10 dB. This document details the measurement and calculation of the processing gain of the Tracer spread spectrum system, marketed by Adtran, Inc. The processing gain of the Tracer was measured using the CW jamming margin method. Guidelines for this method were obtained from the FCC publication “Guidance on Measurements for Direct Sequence Spread Spectrum Systems” found as Appendix C of FCC 97-114. Results of this test, found in section 3 of this document, verify that the Tracer has between 13.5 and 15.5 dB of processing gain, satisfying part 15.247(e) requirements. 1.0 Test Configuration A table of test hardware model numbers and serial numbers is attached as Appendix A. The setup of this test was derived from FCC guidance 1 . Jamming signals were generated with an HP ESG-D3000A signal generator and a frequency doubler. An HP 435B Power Meter was used for power measurements. Mini-Circuits power splitters and an HP 8494B RF attenuator were present in the received signal path. Figure 1 details physical test setup configurations. The Tracer Transmitting Unit transmitted at a center frequency of 5747 MHz and at a power level of approximately 0 dBm. The HP attenuator provided 40 dB of signal loss to ensure a nominal received signal and a 20 dB pad was placed next to the Transmitting Unit to allow for a reading on the power meter to be obtained. Each power meter reading was adjusted accordingly for this extra 20 dB of signal loss. The unit under test (UUT) received at a center frequency of 5747 MHz, and did not provide a transmitting signal onto the coax. The recommended bit error rate (BER) was chosen at 1E-6 for this test. If the UUT lost signal lock before the error rate degraded to this level, the greatest tolerable jammer level was recorded. Page 4 Measurement and Evaluation on Tracer Processing Gain Figure 1 Jamming Test Setup 2.0 Testing Procedure Test data and calculation results are listed in Appendix B. 2.1 Received Signal Power Received signal power was calculated with the power meter. The signal generator’s RF was turned off then the signal was read on the power meter at -22.4 dBm. This combined with the 40 dBm of signal loss from the variable attenuator gives a measured received signal power level of - 62.4 dBm. 2.2 Jammer Power The jamming signal power measurements were made by referring to the power meter. The signal generator was set on frequencies varying from 5725-5787 GHz. At every 50 KHz the jammer signal power was measured then an extra -40 dBm was added for the signal loss through the variable attenuator. 2.3 Jammer to Signal Ratio Jammer to Signal (J/S) calculations were made by taking the jammer and received signal levels and computing the ratio at each frequency. These calculations are shown beside the data in Appendix A. The J/S ratios were then sorted, and the lowest 20% were discarded. The lowest remaining J/S ratio was 4.5 dB. 2.4 Ideal Signal to Noise Ratio of the Tracer System The signal to noise ratio for an ideal differential QPSK system at a 1E-6 bit error rate (BER) is approximately 13 dB 2 . The Tracer system employs an error-correction algorithm that provides 4 dB of gain 3 . This gain improves resistance to jamming signals independent of processing gain. Therefore, the ideal signal to noise ratio for the Tracer system should be 9 dB. Tracer Transmitting Unit (TX) HP ESG-D3000A Signal Generator (SG) HP 435B Power Meter (PM) Tracer Receiving Unit (UUT) HP 8494B Phoenix 5575B Bit Error Rate Tester Freq. Doubler Page 5 Measurement and Evaluation on Tracer Processing Gain 3.0 Tracer System Processing Gain The processing gain of a direct sequence spread spectrum system can be calculated with the following equation: Gp = (S/N)o + Mj + Lsys where: (S/N)o = Signal to noise ratio for a given modulation scheme and bit error rate (BER). Mj = J/S ratio. Lsys = system implementation losses for a practical system. The ideal processing gain for a 12-chip-per-bit spreading system is 10*log(12), or 10.8 dB. Assuming a (S/N)o of 9dB, a measured Mj of 4.5dB, and no system loss (Lsys = 0), the calculated processing gain is 13.5 dB. Assuming 2dB of losses (due to filtering, etc), Gp is 15.5 dB. The actual system processing gain lies somewhere within this range. These calculated gains, with and without system losses, both satisfy the FCC Part 15.247(e) requirement of a minimum 10 dB of processing gain for a direct sequence spread spectrum system. Page 6 Measurement and Evaluation on Tracer Processing Gain 1 “Guidance on Measurements for Direct Sequence Spread Spectrum Systems.” FCC 97-114, Appendix C. Federal Communications Commission, 1997. 2 Bennett, William R. and Davey, James R. Data Transmission. (New York, McGraw-Hill 1965), Pg. 211 3 “Q1650 Viterbi Decoder Technical Data Sheet”. (Qualcomm, Inc. 1995), Pg. 12

Test Equipment Employed in this Test Type Manufacturer Serial Number Signal Generator Hewlett Packard E4432A US37040891 Power Meter Hewlett Packard 435B 2238A04071 Power Splitter Mini Circuits 15542 N/A Bit Error Rate Tester Phoenix Microsystems 5575B 00157403111-04070-24279 RF Attenuator Hewlett Packard 8494B N/A Attenuation Pad Narda 4772-20 N/A Test Measurements and Calculations Freq (MHz) J (dBm) S (dBm) J/S (dB) 5725.00 10.0 -40.0 -62.4 22.4 5725.05 10.0 -40.0 -62.4 22.4 5725.10 10.0 -40.0 -62.4 22.4 5725.15 10.0 -40.0 -62.4 22.4 5725.20 10.0 -40.0 -62.4 22.4 5725.25 10.0 -40.0 -62.4 22.4 5725.30 10.0 -40.0 -62.4 22.4 5725.35 10.0 -40.0 -62.4 22.4 5725.40 10.0 -40.0 -62.4 22.4 5725.45 10.0 -40.0 -62.4 22.4 5725.50 10.0 -40.0 -62.4 22.4 5725.55 10.0 -40.0 -62.4 22.4 5725.60 10.0 -40.0 -62.4 22.4 5725.65 10.0 -40.0 -62.4 22.4 5725.70 10.0 -40.0 -62.4 22.4 5725.75 10.0 -40.0 -62.4 22.4 5725.80 10.0 -40.0 -62.4 22.4 5725.85 10.0 -40.0 -62.4 22.4 5725.90 10.0 -40.0 -62.4 22.4 5725.95 10.0 -40.0 -62.4 22.4 5726.00 10.0 -40.0 -62.4 22.4 5726.05 10.0 -40.0 -62.4 22.4 5726.10 10.0 -40.0 -62.4 22.4 5726.15 10.0 -40.0 -62.4 22.4 5726.20 10.0 -40.0 -62.4 22.4 5726.25 10.0 -40.0 -62.4 22.4 5726.30 10.0 -40.0 -62.4 22.4 5726.35 10.0 -40.0 -62.4 22.4 5726.40 10.0 -40.0 -62.4 22.4 Test Measurements and Calculations Freq (MHz) J (dBm) S (dBm) J/S (dB) 5726.45 10.0 -40.0 -62.4 22.4 5726.50 10.0 -40.0 -62.4 22.4 5726.55 10.0 -40.0 -62.4 22.4 5726.60 10.0 -40.0 -62.4 22.4 5726.65 10.0 -40.0 -62.4 22.4 5726.70 10.0 -40.0 -62.4 22.4 5726.75 10.0 -40.0 -62.4 22.4 5726.80 10.0 -40.0 -62.4 22.4 5726.85 10.0 -40.0 -62.4 22.4 5726.90 10.0 -40.0 -62.4 22.4 5726.95 10.0 -40.0 -62.4 22.4 5727.00 10.0 -40.0 -62.4 22.4 5727.05 10.0 -40.0 -62.4 22.4 5727.10 10.0 -40.0 -62.4 22.4 5727.15 10.0 -40.0 -62.4 22.4 5727.20 10.0 -40.0 -62.4 22.4 5727.25 10.0 -40.0 -62.4 22.4 5727.30 10.0 -40.0 -62.4 22.4 5727.35 10.0 -40.0 -62.4 22.4 5727.40 10.0 -40.0 -62.4 22.4 5727.45 10.0 -40.0 -62.4 22.4 5727.50 10.0 -40.0 -62.4 22.4 5727.55 10.0 -40.0 -62.4 22.4 5727.60 10.0 -40.0 -62.4 22.4 5727.65 10.0 -40.0 -62.4 22.4 5727.70 10.0 -40.0 -62.4 22.4 5727.75 10.0 -40.0 -62.4 22.4 5727.80 10.0 -40.0 -62.4 22.4 5727.85 10.0 -40.0 -62.4 22.4 5727.90 10.0 -40.0 -62.4 22.4 5727.95 10.0 -40.0 -62.4 22.4 5728.00 10.0 -40.0 -62.4 22.4 5728.05 10.0 -40.0 -62.4 22.4 5728.10 10.0 -40.0 -62.4 22.4 5728.15 10.0 -40.0 -62.4 22.4 5728.20 10.0 -40.0 -62.4 22.4 5728.25 10.0 -40.0 -62.4 22.4 5728.30 10.0 -40.0 -62.4 22.4 5728.35 10.0 -40.0 -62.4 22.4 5728.40 10.0 -40.0 -62.4 22.4 5728.45 10.0 -40.0 -62.4 22.4 5728.50 10.0 -40.0 -62.4 22.4 5728.55 10.0 -40.0 -62.4 22.4 5728.60 10.0 -40.0 -62.4 22.4 Test Measurements and Calculations Freq (MHz) J (dBm) S (dBm) J/S (dB) 5728.65 10.0 -40.0 -62.4 22.4 5728.70 10.0 -40.0 -62.4 22.4 5728.75 10.0 -40.0 -62.4 22.4 5728.80 10.0 -40.0 -62.4 22.4 5728.85 10.0 -40.0 -62.4 22.4 5728.90 10.0 -40.0 -62.4 22.4 5728.95 10.0 -40.0 -62.4 22.4 5729.00 10.0 -40.0 -62.4 22.4 5729.05 10.0 -40.0 -62.4 22.4 5729.10 10.0 -40.0 -62.4 22.4 5729.15 10.0 -40.0 -62.4 22.4 5729.20 10.0 -40.0 -62.4 22.4 5729.25 10.0 -40.0 -62.4 22.4 5729.30 10.0 -40.0 -62.4 22.4 5729.35 10.0 -40.0 -62.4 22.4 5729.40 10.0 -40.0 -62.4 22.4 5729.45 10.0 -40.0 -62.4 22.4 5729.50 10.0 -40.0 -62.4 22.4 5729.55 10.0 -40.0 -62.4 22.4 5729.60 10.0 -40.0 -62.4 22.4 5729.65 10.0 -40.0 -62.4 22.4 5729.70 10.0 -40.0 -62.4 22.4 5729.75 10.0 -40.0 -62.4 22.4 5729.80 10.0 -40.0 -62.4 22.4 5729.85 10.0 -40.0 -62.4 22.4 5729.90 10.0 -40.0 -62.4 22.4 5729.95 10.0 -40.0 -62.4 22.4 5730.00 10.0 -40.0 -62.4 22.4 5730.05 10.0 -40.0 -62.4 22.4 5730.10 10.0 -40.0 -62.4 22.4 5730.15 10.0 -40.0 -62.4 22.4 5730.20 10.0 -40.0 -62.4 22.4 5730.25 10.0 -40.0 -62.4 22.4 5730.30 10.0 -40.0 -62.4 22.4 5730.35 10.0 -40.0 -62.4 22.4 5730.40 10.0 -40.0 -62.4 22.4 5730.45 10.0 -40.0 -62.4 22.4 5730.50 10.0 -40.0 -62.4 22.4 5730.55 10.0 -40.0 -62.4 22.4 5730.60 10.0 -40.0 -62.4 22.4 5730.65 10.0 -40.0 -62.4 22.4 5730.70 10.0 -40.0 -62.4 22.4 5730.75 10.0 -40.0 -62.4 22.4 5730.80 10.0 -40.0 -62.4 22.4 Test Measurements and Calculations Freq (MHz) J (dBm) S (dBm) J/S (dB) 5730.85 10.0 -40.0 -62.4 22.4 5730.90 10.0 -40.0 -62.4 22.4 5730.95 10.0 -40.0 -62.4 22.4 5731.00 10.0 -40.0 -62.4 22.4 5731.05 10.0 -40.0 -62.4 22.4 5731.10 10.0 -40.0 -62.4 22.4 5731.15 10.0 -40.0 -62.4 22.4 5731.20 10.0 -40.0 -62.4 22.4 5731.25 10.0 -40.0 -62.4 22.4 5731.30 10.0 -40.0 -62.4 22.4 5731.35 10.0 -40.0 -62.4 22.4 5731.40 10.0 -40.0 -62.4 22.4 5731.45 10.0 -40.0 -62.4 22.4 5731.50 10.0 -40.0 -62.4 22.4 5731.55 10.0 -40.0 -62.4 22.4 5731.60 10.0 -40.0 -62.4 22.4 5731.65 10.0 -40.0 -62.4 22.4 5731.70 10.0 -40.0 -62.4 22.4 5731.75 10.0 -40.0 -62.4 22.4 5731.80 10.0 -40.0 -62.4 22.4 5731.85 10.0 -40.0 -62.4 22.4 5731.90 10.0 -40.0 -62.4 22.4 5731.95 10.0 -40.0 -62.4 22.4 5732.00 10.0 -40.0 -62.4 22.4 5732.05 10.0 -40.0 -62.4 22.4 5732.10 10.0 -40.0 -62.4 22.4 5732.15 10.0 -40.0 -62.4 22.4 5732.20 10.0 -40.0 -62.4 22.4 5732.25 10.0 -40.0 -62.4 22.4 5732.30 10.0 -40.0 -62.4 22.4 5732.35 10.0 -40.0 -62.4 22.4 5732.40 10.0 -40.0 -62.4 22.4 5732.45 10.0 -40.0 -62.4 22.4 5732.50 10.0 -40.0 -62.4 22.4 5732.55 10.0 -40.0 -62.4 22.4 5732.60 10.0 -40.0 -62.4 22.4 5732.65 10.0 -40.0 -62.4 22.4 5732.70 10.0 -40.0 -62.4 22.4 5732.75 10.0 -40.0 -62.4 22.4 5732.80 10.0 -40.0 -62.4 22.4 5732.85 10.0 -40.0 -62.4 22.4 5732.90 10.0 -40.0 -62.4 22.4 5732.95 10.0 -40.0 -62.4 22.4 5733.00 10.0 -40.0 -62.4 22.4 Test Measurements and Calculations Freq (MHz) J (dBm) S (dBm) J/S (dB) 5733.05 10.0 -40.0 -62.4 22.4 5733.10 10.0 -40.0 -62.4 22.4 5733.15 10.0 -40.0 -62.4 22.4 5733.20 10.0 -40.0 -62.4 22.4 5733.25 10.0 -40.0 -62.4 22.4 5733.30 10.0 -40.0 -62.4 22.4 5733.35 10.0 -40.0 -62.4 22.4 5733.40 10.0 -40.0 -62.4 22.4 5733.45 10.0 -40.0 -62.4 22.4 5733.50 10.0 -40.0 -62.4 22.4 5733.55 10.0 -40.0 -62.4 22.4 5733.60 10.0 -40.0 -62.4 22.4 5733.65 10.0 -40.0 -62.4 22.4 5733.70 10.0 -40.0 -62.4 22.4 5733.75 10.0 -40.0 -62.4 22.4 5733.80 10.0 -4…

Text truncated - open the document above for the full version.

Radiated Emissions Test Set Up Front Rear