
Text extracted from the exhibit documents filed with the FCC. Open a document above to read the original.
(QJOLVK'HXWVFK(VSDxRO)UDQFDLV,WDOLDQR0DQGDULQ )&&6WDWHPHQW7KLVGHYLFHFRPSOLHVZLWK3DUWRIWKH)&&UXOHV2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQV !7KLVGHYLFHPD\QRWFDXVHKDUPIXOLQWHUIHUHQFH#DQG !7KLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHUHFHLYHG#LQFOXGLQJLQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHGRSHUDWLRQ +%+ERRN 3DJH )ULGD\ -XO\ $0 (QJOLVK (QJOLVK,QWURGXFWLRQ3UHSDULQJWKHKDQGVIUHH8VLQJWKHKDQGVIUHH7URXEOHVKRRWLQJ$GGLWLRQDO,QIRUPDWLRQ'HFODUDWLRQRI&RQIRUPLW\ (ULFVVRQ+%+ )LUVWHGLWLRQ -XQH7KLVPDQXDOLVSXEOLVKHGE\(ULFVVRQ0RELOH&RPPXQLFDWLRQV$% ZLWKRXWDQ\ZDUUDQW\,PSURYHPHQWVDQGFKDQJHVWRWKLVPDQXDOQHFHVVLWDWHGE\W\SRJUDSKLFDOHUURUV LQDFFXUDFLHVRIFXUUHQWLQIRUPDWLRQ RULPSURYHPHQWVWRSURJUDPVDQGRUHTXLSPHQW PD\EHPDGHE\(ULFVVRQ0RELOH&RPPXQLFDWLRQV$%DWDQ\WLPHDQGZLWKRXWQRWLFH6XFKFKDQJHVZLOO KRZHYHU EHLQFRUSRUDWHGLQWRQHZHGLWLRQVRIWKLVPDQXDO$OOULJKWVUHVHUYHG(ULFVVRQ0RELOH&RPPXQLFDWLRQV$%3XEOLFDWLRQQXPEHU(1/=75$,1129$75213$7(1766RPHRIWKHVHUYLFHVLQWKLVPDQXDODUHQRWVXSSRUWHGE\DOOQHWZRUNV7KLVDOVRDSSOLHVWRWKH*60,QWHUQDWLRQDO(PHUJHQF\1XPEHU&RQWDFW\RXUQHWZRUNRSHUDWRURUVHUYLFHSURYLGHULI\RXDUHLQGRXEWZKHWKHU\RXFDQXVHDSDUWLFXODUVHUYLFHRUQRW7KH %/8(7227+ WUDGHPDUNVDUHRZQHGE\WKHLUSURSULHWRUDQG XVHGE\(ULFVVRQXQGHUOLFHQVH,PSRUWDQW,QIRUPDWLRQ&DXWLRQ &KDQJHVRUPRGLILFDWLRQVQRWH[SUHVVO\DSSURYHGE\ (ULFVVRQZLOOYRLGWKHXVHU8VDXWKRULW\WRRSHUDWHWKHHTXLSPHQW +%+ERRN 3DJH )ULGD\ -XO\ $0 (QJOLVK ,QWURGXFWLRQ7KH %OXHWRRWK KDQGVIUHH +%+LVDSRUWDEOHKDQGVIUHHVROXWLRQEDVHGRQ %OXHWRRWK ZLUHOHVVWHFKQRORJ\ 6HH³*XLGHOLQHVIRUVDIHDQGHIILFLHQWXVH ́RQ SDJHDQG³/LPLWHGZDUUDQW\ ́RQSDJHEHIRUHXVLQJ\RXUKDQGVIUHH:KDWLV %OXHWRRWK ZLUHOHVVWHFKQRORJ\" 7KH %OXHWRRWK ZLUHOHVVWHFKQRORJ\PDNHVLWSRVVLEOHWR FRQQHFWDQ\FRPSDWLEOHSRUWDEOHDQGVWDWLRQDU\FRPPXQLFDWLRQVGHYLFHZLWKRXWXVLQJFDEOHV7KHWHFKQRORJ\LVEDVHGRQDUDGLROLQNWKDWRIIHUVIDVWDQGUHOLDEOHWUDQVPLVVLRQRIYRLFHDQGGDWDLQIRUPDWLRQ,WGRHVQRWUHTXLUHDOLQHRIVLJKWFRQQHFWLRQLQRUGHUWRHVWDEOLVKFRPPXQLFDWLRQ %OXHWRRWK ZLUHOHVV WHFKQRORJ\XVHVDJOREDOO\DYDLODEOHIUHTXHQF\UDQJHLQWHQGHGWRHQVXUHFRPPXQLFDWLRQFRPSDWLELOLW\ZRUOGZLGH:KHQFDQ,XVHP\KDQGVIUHH"<RXFDQFRQQHFW\RXU+%+KDQGVIUHHWR\RXUPRELOHSKRQHRU3&±RUDQ\GHYLFHZLWK %OXHWRRWK ZLUHOHVVWHFKQRORJ\WKDWVXSSRUWVWKHKDQGVIUHHSURILOH ±WRNHHS\RXUKDQGVIUHHIRUPRUHLPSRUWDQWWDVNVZKHQ\RXDUHDWWKHRIILFHRULQWKHFDU7KLVXVHU¶VJXLGHIRFXVHVRQKRZWRXVHWKHKDQGVIUHHZLWK\RXUPRELOHSKRQH:KHQWKHKDQGVIUHHLVFRQQHFWHGWR\RXUPRELOHSKRQH/\RXFDQXVHYRLFHFRQWUROWRPDNHFDOOV0LI\RXUSKRQHVXSSRUWVWKLVIXQFWLRQ17KHSKRQHFDQEHWXFNHGDZD\LQ\RXUSRFNHWRULQDEDJ<RXFDQKDQGOHLQFRPLQJDQGRXWJRLQJFDOOV/DQGDGMXVWWKHYROXPH/XVLQJWKHEXWWRQVRQWKHKDQGVIUHH3UHSDULQJWKHKDQGVIUHH7REHDEOHWRXVHWKHKDQGVIUHHWRJHWKHUZLWKDPRELOHSKRQH/\RXQHHGWRKDYHDSKRQHZLWKEXLOWLQ%OXHWRRWK FDSDELOLW\/RUDSKRQHZLWKD %OXHWRRWK DGDSWHUFRQQHFWHGWRLW +%+ERRN 3DJH )ULGD\ -XO\ $0 (QJOLVK 2YHUYLHZ1RWH $OZD\V KDQGOH WKH KDQGVIUHH ZLWK FDUH 6WUDS (DUSLHFHKROGHU(DUSLHFH 0LFURSKRQH 9ROXPHEXWWRQV ,QGLFDWRUOLJKW &KDUJLQJFRQQHFWRU +DQGVIUHHFRQQHFWRU &DOOKDQGOLQJEXWWRQV +%+ERRN 3DJH )ULGD\ -XO\ $0 (QJOLVK *HWWLQJ6WDUWHG%HIRUH\RXVWDUWXVLQJWKHKDQGVIUHHZLWKDSKRQHRURWKHUGHYLFHIRUWKHILUVWWLPH/\RXVKRXOG &KDUJHWKHKDQGVIUHHXVLQJDQDSSURSULDWH(ULFVVRQ FKDUJHU 3DLUWKHKDQGVIUHHZLWKDGHYLFH/IRUH[DPSOH/DPRELOH SKRQH 0DNHVXUHWKHKDQGVIUHHLVZLWKLQUDQJH0XSWRP IWZLWKQRVROLGREMHFWVLQEHWZHHQ1&KDUJLQJ7KHKDQGVIUHHFRPHVZLWKDEXLOWLQUHFKDUJHDEOHEDWWHU\7KHEDWWHU\LVQRWIXOO\FKDUJHGZKHQ\RXEX\WKHKDQGVIUHH:HUHFRPPHQGWKDW\RXFKDUJHWKHKDQGVIUHHXQWLOWKHLQGLFDWRUOLJKWWXUQVJUHHQEHIRUHXVLQJLWIRUWKHILUVWWLPH 7RUHPLQG\RXWKDW\RXZLOOVRRQQHHGWRUHFKDUJHWKH EDWWHU\/WKHKDQGVIUHHLQGLFDWRUOLJKWIODVKHVUHGZKHQWKHKDQGVIUHHLVRQ ,WWDNHVKRXUVWRIXOO\UHFKDUJHWKHEDWWHU\ 'XULQJFKDUJLQJ/WKHLQGLFDWRUOLJKWVKRZVDVWHDG\UHG OLJKWZKHQWKHKDQGVIUHHLVWXUQHGRII/DQGIODVKHVUHGZKHQWKHKDQGVIUHHLVRQ :KHQWKHEDWWHU\LVIXOO\FKDUJHG/WKHLQGLFDWRUVKRZV DVWHDG\JUHHQOLJKWLIWKHKDQGVIUHHLVRII/RUDIODVKLQJJUHHQOLJKWLIWKHKDQGVIUHHLVRQ&RPSDWLEOHFKDUJHUV<RXFDQDWWDFKWKHIROORZLQJFKDUJHUWRWKH+%+ (ULFVVRQ7UDYHO&KDUJHU&75 7R FKDUJH WKH EDWWHU\ 2SHQWKHUXEEHUSOXJDWWKHWRS ULJKWRIWKHKDQGVIUHH+ROGWKHKDQGVIUHHHXSVLGHGRZQ &RQQHFWWKHFKDUJHUWRWKH KDQGVIUHHDQGWRWKHPDLQV7KHIODVKV\PERORQWKHSOXJPXVWIDFHXSZDUGV 7R GLVFRQQHFW WKH FKDUJHU 7LOWWKHFKDUJHUSOXJXSZDUGVWR UHPRYHLW 3XVKWKHUXEEHUSOXJEDFNLQWR SODFH +%+ERRN 3DJH )ULGD\ -XO\ $0 (QJOLVK ,QVWUXFWLRQV,QVWUXFWLRQVLQWKLVXVHU¶VJXLGHDUHEDVHGRQKDQGVIUHHEXWWRQVDQGSKRQHNH\V)RUH[DPSOH/WKH EXWWRQRUWKH <(6 NH\RQWKHSKRQHFDQEHXVHGWRDQVZHUD FDOO7R WXUQ WKH KDQGVIUHH RQ 3UHVVDQGKROGWKH EXWWRQXQWLO\RXKHDUDVKRUW ORZWRQHIROORZHGE\DVKRUWKLJKWRQH7KHKDQGVIUHHLQGLFDWRUOLJKWIODVKHVJUHHQ,IWKHEDWWHU\LVORZ/WKHOLJKWIODVKHVUHG7R WXUQ WKH KDQGVIUHH RII 3UHVVDQGKROGWKH EXWWRQXQWLO\RXKHDUDVKRUW KLJKWRQHIROORZHGE\DVKRUWORZWRQH7KHKDQGVIUHHLQGLFDWRUOLJKWLVVZLWFKHGRII3DLULQJWKHKDQGVIUHH%HIRUH\RXVWDUWXVLQJWKHKDQGVIUHHIRUWKHILUVWWLPH/\RXPXVWSDLUWKHKDQGVIUHHZLWKWKHGHYLF…
Text truncated - open the document above for the full version.
Application PBY8505002 Response to e-mail dated September 20 th 2001 regarding additional information to be filed regarding Ericsson’s Bluetooth Headset marked PBY8505002 Page 1 of 2 Answer to 1) Please check Exhibit 13 Modified Request for Confidentiality.pdf, uploaded on September 25 th . Answer to 2) Please check Exhibit 9 Additional Internal Photographs.pdf, uploaded on September 25 th . Answer to 3) : coordination requirement in data mode The hopping sequence applied uses all 79 frequencies and is a very long sequence determined by the master's identity. (Each Bluetooth unit has a unique identity.) The phase in the sequence is determined by the system clock of the master. So transmissions start always at a random frequency in the band. Data transmission is not synchronized to initiate on any specific frequency or any event not originating from the piconet. There are no provisions for coordination between various piconets or other frequency hopping systems. Occasional loss of data frames due to collisions on a channel are handled by a retransmission, but the hopping goes on. Acknowledgement of received packets is used to support this feature. See also responses to question 3, 4 and 5 Answer to 5): equal frequency use in data mode A communication channel shared by two devices (master and slave) is called a piconet. This channel is divided into fixed length slots. Each slot lasts 625 us and is always placed at a different hop frequency. The nominal hop rate is 1600 hops/s. The hop sequence applied uses on average all 79 frequencies and is a very long sequence determined by the master's identity. (Each Bluetooth unit has a unique identity.) The phase in the sequence is determined by the system clock of the master. So transmissions start always at a random frequency in the band. Data transmission is not synchronized to initiate on any specific frequency. (See also the response to question 4 for details about the generation of these frequencies.) Answer to 6) : receiver matching bandwidth and sync in data mode The receiver bandwidth = 1 MHz. During connection establishment, the master identity and clock are transferred to the slave unit so it can synchronize to the channel. The master clock in a slave unit is obtained by adding an offset to the internal clock of the slave. When the connection is released, the Bluetooth device will return to its own (free-running) clock. Synchronization uses a system of beacon channels generated by the master unit with the remaining slave unit periodically waking up and listening on a beacon channel. Beacon channels are designated by the master unit during paging to identify a communication channel for the slave unit to listen to. The beacon channel packet also contains the synchronization information required for the slave to sync with the master unit. During paging mode the same 32-hop segment is used and the segment is selected by the address with different units having different paging segments. See also: the response to question 4 and 5. Application PBY8505002 Response to e-mail dated September 20 th 2001 regarding additional information to be filed regarding Ericsson’s Bluetooth Headset marked PBY8505002 Page 2 of 2 Answer to 4) : pseudorandom hop sequence in data mode In the data mode the device uses a pseudorandom hopping sequence of 79 channels. Each unit will synchronize to the hopping sequence randomly selected by the master unit. The hop selection kernel for the 79 hop system is shown in the figure below. The X input determines the phase in the 32-hop segment, whereas Y1 and Y2 selects between master-to-slave and slave-to-master transmission. The inputs A to D determine the ordering within the segment, the inputs E and F determine the mapping onto the hop frequencies. In this way a pseudo random hopping sequence is generated. list of channel frequencies in data mode Channel 0 : 2402 MHz Channel 1 : 2403 MHz Channel n : 2402 + n MHz Channel 78: 2480 MHz sample of a few hop sequences in data mode 09, 52, 51, 36, 45, 68, 53, 20, 43, 13, 02, 68, 69, 21, 06, 60, 65, 45, 36, 21, 22, 53, 38, 20, 41, 42, 49, 59, 67, 36, 55, 12, 63, 20, 61, 60, 68, 65, 52, 75, 30, 04, 71, 00, 77, 06, 70, 46, 24, 23, 08, 31, 16, 29, 56, 64, 40, 73, 02, 71, 44, 00, 52, 77, 13, 06, 75, 04, 10, 18, 66, 08, 42, 16, 50, 14, 11, 22, 19, 12, 74, 03, 62, 24, 46, 32, 54, 30, 15, 38 23, 28, 78, 36, 57, 65, 55, 63, 48, 61, 09, 69, 17, 59, 72, 67, 01, 20, 03, 36, 19, 16, 74, 11, 38, 51, 18, 34, 44, 60, 21, 40, 76, 56, 13, 46, 37, 62, 53, 42, 29, 58, 45, 07, 48, 78, 64, 15, 54, 70, 50, 66, 47, 12, 01, 28, 17, 08, 72, 24, 09, 14, 33, 49, 26, 41, 50, 37, 66, 53, 48, 64, 54, 70, 52, 61, 77, 51, 09, 43 PERM5 A 5 X O R 5 mod32 B 4 E 7 D 9 F 7 Y1 XOR C 5 5 5 57 X 5 mod79 ADD ADD Y2 | 3 | 1 | 77 4 2 0 | 78
CETECOM ICT Services GmbH Test report nr..: 2-2391-A/01Issue Date: 18.07.2001Page 47 (51) Photographs of the equipment CETECOM ICT Services GmbH Test report nr..: 2-2391-A/01Issue Date: 18.07.2001Page 48 (51) Photographs of the equipment
Limited Internal MARKING DRAWING1 (2) Prepared (also subject responsible if other)No. ELN/L/TT Bennie Rolink151 86 - KRY 901 80 Uen ApprovedCheckedDateRevReference ELN/L/TT Marten van Wijhe2001-03-27B SVEND - BLUETOOTH HEADSET 1 Marking Marking should be done according to the specifications below. Dimensions are given in mm. The marking is divided into 2 parts. One part is printed on a label and one part is moulded in the tool of the body bottom SXA 214 2753. 1.1 LABEL Line 1 Bluetooth logo (X1.5, Y7). The baseline of the name "Bluetooth" is on Y7. After applying the logo to the label the capital B in the name of the logo must be 2.5 mm high. Line 2 <Product ABC code>, Arial 4 pt (X0.5, Y4.5). <R-state>, Arial 4 pt (X11, Y4.5). Product ABC code and R-state according to order. Line 3 Commercial product ID (HBH-20), Arial 4 pt (X0.5, Y2.5). Year/week indication, Arial 3.5 pt, (X8, Y2.5). Example 01W12. Line 4 BDAddress, Arial 4 pt, (X0.5, Y0.75). 1.2 MOULDED Line 1 C-tick logo with code N173, height 2.5 mm, (X2.0, Y7.0) Line 2 type and FCC ID: PBY8505002, Arial 3.5 pt (X1.0, Y5.5) Line 3 MADE IN <country of origin>, Arial 3.5 pt, capital (X1.0, Y4.0). Code for manufacturing unit, according to 102 01-101 Uen: S61, Arial 3.5 pt, (X14, Y4.0). Line 4 CE logo, according to 1424-SVF 930 52, height 2.5 mm, (X2.0, Y0.75). Notified body ID 0682, Arial 2.5 mm, (X6.0, Y0.75). Alert sign, according to 1424-SVF 930 196, height 2.5 mm, (X13.5, Y0.75). 1.3 Brandname The brandname will be moulded in the clip (non removable). Limited Internal MARKING DRAWING2 (2) Prepared (also subject responsible if other)No. ELN/L/TT Bennie Rolink151 86 - KRY 901 80 Uen ApprovedCheckedDateRevReference ELN/L/TT Marten van Wijhe2001-03-27B Example of the label and marking. KRY 901 80/01 P1A HBH-20 yyWww BDA 012345678902 type and FCC ID: PBY8505002 MADE IN FINLAND S61 0682 N173 Label under cosmetic part (18 x 10 mm max.) In tool under clip (20 x 10 mm max.) Y X KRY 901 80/01 P1A HBH-20 yyWww BDA 012345678902 type and FCC ID: PBY8505002 MADE IN FINLAND S61 0682 N173 Y X Limited Internal PLACEMENT MARKING HBH-201 (1) Prepared (also subject responsible if other)No. ELN/L/T R.H. Linde Uen ApprovedCheckedDateRevReference 24-7-01PA1 Marking in mould of plastics According to spec Placement of label According to spec Decorative part
CETECOM ICT Services GmbH Test report nr..: 2-2391-A/01Issue Date: 18.07.2001Page 49 (51) Photographs of the equipment CETECOM ICT Services GmbH Test report nr..: 2-2391-A/01Issue Date: 18.07.2001Page 50 (51) Photographs of the equipment CETECOM ICT Services GmbH Test report nr..: 2-2391-A/01Issue Date: 18.07.2001Page 51 (51) Photographs of the equipment
Application PBY8505002 Exhibit 9: Additional Internal Photographs
(QJOLVK'HXWVFK(VSDxRO)UDQFDLV,WDOLDQR0DQGDULQ )&&6WDWHPHQW7KLVGHYLFHFRPSOLHVZLWK3DUWRIWKH)&&UXOHV2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQV !7KLVGHYLFHPD\QRWFDXVHKDUPIXOLQWHUIHUHQFH#DQG !7KLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHUHFHLYHG#LQFOXGLQJLQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHGRSHUDWLRQ +%+ERRN 3DJH )ULGD\ -XO\ $0 (QJOLVK RQKWWSPRELOHLQWHUQHWHULFVVRQFRPIRUPRUHLQIRUPDWLRQ $GGLWLRQDO,QIRUPDWLRQ *XLGHOLQHVIRUVDIHDQGHIILFLHQWXVH1RWH 5HDGWKLVLQIRUPDWLRQEHIRUHXVLQJ\RXU%OXHWRRWK+DQGVIUHH &KDQJHVRUPRGLILFDWLRQVWRWKLV%OXHWRRWK+DQGVIUHHQRWH[SUHVVO\DSSURYHGE\(ULFVVRQPD\YRLGWKHXVHU)VDXWKRULW\WRRSHUDWHWKHHTXLSPHQW3OHDVHFKHFNIRUDQ\H[FHSWLRQV#GXHWRQDWLRQDOUHTXLUHPHQWVRUOLPLWDWLRQV#LQXVDJHRI%OXHWRRWKHTXLSPHQWEHIRUHXVLQJWKLVSURGXFW$WWDFKWKLV%OXHWRRWK+DQGVIUHHWR(ULFVVRQHTXLSPHQWRQO\3URGXFWFDUH3OHDVHQRWHRQO\(ULFVVRQ&HUWLILHG6HUYLFH3DUWQHUVVKRXOGUHPRYHRUUHSODFHWKHEDWWHU\ 'RQRWH[SRVH\RXUSURGXFWWROLTXLGRUPRLVWXUHRUWRKXPLGLW\ 'RQRWH[SRVH\RXUSURGXFWWRH[WUHPHKLJKRUORZWHPSHUDWXUHV 'RQRWH[SRVH\RXUSURGXFWWROLWFDQGOHV#FLJDUHWWHV#RUFLJDUV#RUWRRSHQ IODPHVHWF 'RQRWGURS#WKURZRUWU\WREHQGWKHSURGXFWDVURXJKWUHDWPHQWFRXOG GDPDJHLW 'RQRWXVHDQ\RWKHUDFFHVVRULHVWKDQ(ULFVVRQRULJLQDOV8VHRIQRQ (ULFVVRQRULJLQDODFFHVVRULHVPD\UHVXOWLQORVVRISHUIRUPDQFH#GDPDJHWRWKHSURGXFW#ILUH#HOHFWULFVKRFNRULQMXU\7KHZDUUDQW\GRHVQRWFRYHUSURGXFWIDLOXUHVZKLFKKDYHEHHQFDXVHGE\XVHRIQRQ(ULFVVRQRULJLQDODFFHVVRULHV 'RQRWDWWHPSWWRGLVDVVHPEOH\RXUSURGXFW7KHSURGXFWGRHVQRW FRQWDLQFRQVXPHUVHUYLFHDEOHRUUHSODFHDEOHFRPSRQHQWV2QO\(ULFVVRQ&HUWLILHG6HUYLFH3DUWQHUVVKRXOGSHUIRUPVHUYLFH 'RQRWNHHSWKHSURGXFWLQDQDUHDSURQHWRGXVWDQGGLUW2QO\XVHDVRIW GDPSFORWKWRFOHDQ\RXUSURGXFW ,I\RXZLOOQRWEHXVLQJWKHSURGXFWIRUDZKLOH#VWRUHLWLQDSODFHWKDWLV GU\#IUHHIURPGDPS#GXVWDQGH[WUHPHWHPSHUDWXUHV +%+ERRN 3DJH )ULGD\ -XO\ $0 (QJOLVK 5DGLRIUHTXHQF\H[SRVXUH<RXU%OXHWRRWK+DQGVIUHHLVDUDGLRWUDQVPLWWHUDQGUHFHLYHU:KHQLQRSHUDWLRQ#LWFRPPXQLFDWHVZLWKD%OXHWRRWKHTXLSSHGPRELOHGHYLFHE\UHFHLYLQJDQGWUDQVPLWWLQJUDGLRIUHTXHQF\ 5)!HOHFWURPDJQHWLFILHOGV PLFURZDYHV!LQWKHIUHTXHQF\UDQJHWR0+]7KHRXWSXWSRZHURIWKHUDGLRWUDQVPLWWHULVORZ#ZDWW<RXU%OXHWRRWK+DQGVIUHHLVGHVLJQHGWRRSHUDWHLQFRPSOLDQFHZLWKWKH5)H[SRVXUHJXLGHOLQHVDQGOLPLWVVHWE\QDWLRQDODXWKRULWLHVDQGLQWHUQDWLRQDOKHDOWKDJHQFLHVZKHQXVHGZLWKDQ\FRPSDWLEOH(ULFVVRQPRELOHSKRQH'ULYLQJ&KHFNWKHODZVDQGUHJXODWLRQVRQWKHXVHRIPRELOHSKRQHVDQGKDQGVIUHHHTXLSPHQWLQWKHDUHDVZKHUH\RXGULYH$OZD\VJLYHIXOODWWHQWLRQWRGULYLQJDQGSXOORIIWKHURDGDQGSDUNEHIRUHPDNLQJRUDQVZHULQJDFDOOLIGULYLQJFRQGLWLRQVVRUHTXLUH5)HQHUJ\PD\DIIHFWVRPHHOHFWURQLFV\VWHPVLQPRWRUYHKLFOHVVXFKDVFDUVWHUHR#VDIHW\HTXLSPHQWHWF&KHFNZLWK\RXUYHKLFOHPDQXIDFWXUHU)VUHSUHVHQWDWLYHWREHVXUHWKDW\RXPRELOHSKRQHRU%OXHWRRWK+DQGVIUHHZLOOQRWDIIHFWWKHHOHFWURQLFV\VWHPVLQ\RXUYHKLFOH(OHFWURQLFHTXLSPHQW0RVWPRGHUQHOHFWURQLFHTXLSPHQWLVVKLHOGHGIURP5)HQHUJ\+RZHYHU#FHUWDLQHOHFWURQLFHTXLSPHQWLVQRW#WKHUHIRUH'RQRWXVH\RXU%OXHWRRWK+DQGVIUHHQHDUPHGLFDOHTXLSPHQWZLWKRXWUHTXHVWLQJSHUPLVVLRQ,I\RXDUHXVLQJDQ\SHUVRQDOPHGLFDOGHYLFHV#HJDSDFHPDNHURUDKHDULQJDLG#SOHDVHUHDGLQ\RXUPRELOHSKRQH)V8VHU)V*XLGHIRUIXUWKHULQIRUPDWLRQ$LUFUDIW7XUQ\RXU%OXHWRRWK+DQGVIUHH2))EHIRUHERDUGLQJDQ\DLUFUDIW7RSUHYHQWLQWHUIHUHQFHZLWKFRPPXQLFDWLRQV\VWHPV#\RXPXVWQRWXVH\RXU%OXHWRRWK+DQGVIUHHZKLOHWKHSODQHLVLQWKHDLU %ODVWLQJDUHDV7XUQRIIDOO\RXUHOHFWURQLFGHYLFHVZKHQLQDEODVWLQJDUHDRULQDUHDVSRVWHG WXUQRIIWZRZD\UDGLR WRDYRLGLQWHUIHULQJZLWKEODVWLQJ RSHUDWLRQV&RQVWUXFWLRQFUHZVRIWHQXVHUHPRWHFRQWURO5)GHYLFHVWRVHWRIIH[SORVLYHV3RWHQWLDOO\H[SORVLYHDWPRVSKHUHV7XUQRII\RXUHOHFWURQLFGHYLFHZKHQLQDQ\DUHDZLWKDSRWHQWLDOO\H[SORVLYHDWPRVSKHUH,WLVUDUH#EXW\RXUHOHFWURQLFGHYLFHFRXOGJHQHUDWHVSDUNV6SDUNVLQVXFKDUHDVFRXOGFDXVHDQH[SORVLRQRUILUHUHVXOWLQJLQERGLO\LQMXU\RUHYHQGHDWK$UHDVZLWKDSRWHQWLDOO\H[SORVLYHDWPRVSKHUHDUHRIWHQ#EXWQRWDOZD\V#FOHDUO\PDUNHG3RZHUVXSSO\&RQQHFWWKH$&SRZHUDGDSWHURQO\WRGHVLJQDWHGSRZHUVRXUFHVDVPDUNHGRQWKHSURGXFW7RUHGXFHULVNRIGDPDJHWRWKHHOHFWULFFRUG#UHPRYHLWIURPWKHRXWOHWE\KROGLQJRQWRWKH$&DGDSWHUUDWKHUWKDQWKHFRUG0DNHVXUHWKHFRUGLVSRVLWLRQHGVRWKDWLWZLOOQRWEHVWHSSHGRQ#WULSSHGRYHURURWKHUZLVHVXEMHFWHGWRGDPDJHRUVWUHVV7RUHGXFHULVNRIHOHFWULFVKRFN#XQSOXJWKHXQLWIURPDQ\SRZHUVRXUFHEHIRUHDWWHPSWLQJWRFOHDQLW7KH$&SRZHUDGDSWHUPXVWQRWEHXVHGRXWGRRUVRULQGDPSDUHDV'$1*(51HYHUDOWHUWKH$&FRUGRUSOXJ,IWKHSOXJZLOOQRWILWLQWRWKHRXWOHW#KDYHDSURSHURXWOHWLQVWDOOHGE\DTXDOLILHGHOHFWULFLDQ,PSURSHUFRQQHFWLRQFDQUHVXOWLQULVNRIHOHFWULFVKRFN&KLOGUHQ'RQRWDOORZFKLOGUHQWRSOD\ZLWK\RXU%OXHWRRWK+DQGVIUHHVLQFHLWFRQWDLQVVPDOOSDUWVWKDWFRXOGEHFRPHGHWDFKHGDQGFUHDWHDFKRNLQJKD]DUG(PHUJHQF\FDOOV,03257$177KLV%OXHWRRWK+DQGVIUHHDQGWKHHOHFWURQLFGHYLFHFRQQHFWHGWRWKHKDQGVIUHHRSHUDWHXVLQJUDGLRVLJQDOV#FHOOXODUDQGODQGOLQHQHWZRUNVDV +%+ERRN 3DJH )ULGD\ -XO\ $0 (QJOLVK ZHOODVXVHUSURJUDPPHGIXQFWLRQV#ZKLFKFDQQRWJXDUDQWHHFRQQHFWLRQXQGHUDOOFRQGLWLRQV7KHUHIRUH\RXVKRXOGQHYHUUHO\VROHO\XSRQDQ\HOHFWURQLFGHYLFHIRUHVVHQWLDOFRPPXQLFDWLRQV HJPHGLFDOHPHUJHQFLHV!5HPHPEHU#LQRUGHUWRPDNHRUUHFHLYHFDOOV#WKHKDQGVI…
Text truncated - open the document above for the full version.
CETECOM ICT Services GmbH Radio Satellite Communication Untertürkheimer Straße 6-10 . D-66117 SaarbrückenTelefon: +49 (0)681 598-0Telefax: -9075 RSC14issue test report consist of 51 PagesPage 1 (51) Test report no.: 2-2391-A/01 FCC Part 15.247 / CANADA RSS-210 ERICSSON 8505002 Accredited Testing Laboratory DAR-Registration number: TTI-P-G 166/98-20 CETECOM ICT Services GmbH Test report nr.:2-2391-A/01Issue date: 18.07.2001Page 2 (51) Table of Contents 1 General information 1.1 Notes 1.2 Testing laboratory 1.3 Details of applicant 1.4 Application details 1.5 Test item 1.6 Test standards 2 Technical test 2.1 Summary of test results 2.2 Test report 1 General information 1.1 Notes The test results of this test report relate exclusively to the test item specified in 1.5. The CETECOM ICT Services GmbH does not assume responsibility for any conclusions and generalisations drawn from the test results with regard to other specimens or samples of the type of the equipment represented by the test item. The test report may only be reproduced or published in full. Reproduction or publication of extracts from the report requires the prior written approval of the CETECOM ICT Services GmbH. 1.2Testing laboratory CETECOM ICT Services GmbH Untertürkheimer Straße 6 - 10 66117 Saarbrücken Germany Telefone: + 49 681 598 - 0 Telefax : + 49 681 598 - 9075 E-mail : [email protected] Internet : www.cetecom.de Accredited testing laboratory DAR-registration number : TTI-P-G 166/98-20 CETECOM ICT Services GmbH Test report nr.:2-2391-A/01Issue date: 18.07.2001Page 3 (51) 1.3Details of applicant Name : ERICSSON Eurolab Netherlands BV Street : Nieuw Amsterdamsestraat 40 City : 7814 VA Emmen Country : Netherlands Telephone : +31 591 637 597 Telefax : +31 591 632 784 Contact : Mr. Henry Hofstede Telephone : +31 591 637 597 1.4Application details Date of receipt of application : 17.07.01 Date of receipt of test item : 17.07.01 Date of test : 17.07.01 1.5Test item Type of equipment : Bluetooth headset Type designation: 8505002 Manufacturer: applicant Street: City: Country: Serial number: Additional informations: : Frequency: 2400 – 2483.5 MHz Type of modulation: 1M00FXD / 79M8FXD (FHSS) Number of channels : 79 Antenna: integral antenna Power supply: 3,8 V DC Lithium cell Output power rad. max.: EIRP: 0,85 mW Type of equipment: Temperature range : 0°C - +35°C 1.6Test standards: FCC Part 15 §15.247 CANADA RSS-210 CETECOM ICT Services GmbH Test report nr.:2-2391-A/01Issue date: 18.07.2001Page 4 (51) 2 Technical test 2.1Summary of test results The measurements were performed only radiated. There were no possibility to make a coaxial connection. All measurements were performed verticaly and horizontaly. Horizontal results were 7dB and more lower than in vertical position. Antenna gain was declared by ERICSSON . All measurement settings are according to FCC 15.35, 15.205, 15.209, 15.247 and the „Measurement guidelines for FHSS systems“. The product fullfills also the requirements for CANACA RSS-210 No deviations from the technical specification(s) were ascertained in the course of the tests performed. Final verdict : PASS Technical responsibility for area of testing : 23.07.01RSC 8411 Berg M. DateSectionNameSignature Technical responsibility for area of testing : 23.07.01RSC8414Ames H. DateSectionNameSignature CETECOM ICT Services GmbH Test report nr.:2-2391-A/01Issue date: 18.07.2001Page 5 (51) 2.2Testreport TEST REPORT Testreport no. : 2-2391-A/01 CETECOM ICT Services GmbH Test report nr.:2-2391-A/01Issue date: 18.07.2001Page 6 (51) TEST REPORT REFERENCE LIST OF MEASUREMENTS ParagraphPARAMETER TO BE MEASUREDPAGE Transmitter parameters § 15.204Antenna gain 7 § 15.247 (a) Carrier frequency separation8 § 15.247 (a)Number of hopping channels9 § 15.247 (a)Time of occupancy (dwell time)13 § 15.247 (d) Power spectral density (Inquiry/Page mode)18 § 15.247 (a)(1) Spectrum bandwidth of a FHSS System19 § 15.247 (b)(2) Maximum peak output power24 §15.247Band edge compliance25 § 15.247 (c)(1) Emission limitations 27 Receiver parameters § 15.209Spurious radiations - Radiated38 Test equipment listing43 Photographs of the equipment45 CETECOM ICT Services GmbH Test report nr..: 2-2391-A/01Issue Date: 18.07.2001Page 7 (51) Equipment under test : 8505002 Ambient temperature : 23° °° °C Relative humidity : 41% REFERENCE NUMBER(S) OF TEST EQUIPMENT USED (for reference numbers see test equipment listing) - Antenna GainSUBCLAUSE § 15.204 The gain is –1,0 dBi max. ( declared by ERICSSON) CETECOM ICT Services GmbH Test report nr..: 2-2391-A/01Issue Date: 18.07.2001Page 8 (51) Equipment under test : 8505002 Ambient temperature : 23° °° °C Relative humidity : 41% REFERENCE NUMBER(S) OF TEST EQUIPMENT USED (for reference numbers see test equipment listing) 64 Carrier frequency separation §15.247(a) Ref Lvl -20 dBm Ref Lvl -20 dBm RF Att 10 dB A Unit dBm 300 kHz/Center 2.441 GHzSpan 3 MHz RBW 10 kHz VBW 10 kHz SWT 76 ms 1MAX1MA -120 -110 -100 -90 -80 -70 -60 -50 -40 -30 -20 1 1 2 Marker 1 [T1] -30.38 dBm 2.43999299 GHz 1 [T1] -30.38 dBm 2.43999299 GHz 1 [T1] 2.80 dB 997.99599198 kHz 2 [T1] 0.98 dB 2.00200401 MHz Date: 17.JUL.2001 14:02:43 CETECOM ICT Services GmbH Test report nr..: 2-2391-A/01Issue Date: 18.07.2001Page 9 (51) Equipment under test : 8505002 Ambient temperature : 23° °° °C Relative humidity : 41% REFERENCE NUMBER(S) OF TEST EQUIPMENT USED (for reference numbers see test equipment listing) 64 Number of hopping channels§15.247(a) Part 1 1MAX Ref Lvl -20 dBm Ref Lvl -20 dBm RF Att 10 dB A 1MA Unit dBm Center 2.409 GHzSpan 27 MHz2.7 MHz/ SWT 5 ms RBW 300 kHz VBW 300 kHz -120 -110 -100 -90 -80 -70 -60 -50 -40 -30 -20 F1 F2 Date: 17.JUL.2001 14:09:26 The left red line is at 2400 MHz. The right red line is at 2420 MHz and is equal to the left red line on the next page. The number of hopping channels is 79. CETECOM ICT Services GmbH Test report nr..: 2-2391-A/01Issue Date: 18.07.2001Page 10 (51) Equipment under test : 8505002 Ambient temp…
Text truncated - open the document above for the full version.
CONFIDENTIAL REPORT1 (122) Uppgjord (även faktaansvarig om annan) - Prepared (also subject responsible if other)Nr - No. ELN/TA/ Frank Hooijschuur ELN/TG/ Ger Bargerbos ELN/TG/8404003BV/A1 Dokansv/Godk - Doc respons/ApprovedKontr – CheckedDatum - Date RevFile 2001-24-01A18404003BVprocgain.doc C:\windows\TEMP\8404003bvprocgain.doc EN/FAD 109 251 R1B PROCESSING GAIN MEASUREMENT RESULTS OF ERICSSON’S BLUETOOTH RADIO MODULE USING THE CW-JAMMING MARGIN METHOD Abstract This paper presents results concerning the processing gain (PG) for Ericsson’s Bluetooth radio module when measured according to FCC’s CW-jamming margin method. The PG from the direct sequence spreading caused by the access code in page and inquiry mode is found to be about 4 dB for three different access codes, with considerably different properties. Therefore, since Bluetooth in page and inquiry is considered as a hybrid system which is required to have a total PG of 17 dB, and the PG from the frequency hopping part is 15 dB, it is concluded that Ericsson’s radio module passes the test with a margin of about 2 dB. CONFIDENTIAL REPORT2 (122) Uppgjord (även faktaansvarig om annan) - Prepared (also subject responsible if other)Nr - No. ELN/TA/ Frank Hooijschuur ELN/TG/ Ger Bargerbos ELN/TG/8404003BV/A1 Dokansv/Godk - Doc respons/ApprovedKontr – CheckedDatum - Date RevFile 2001-24-01A18404003BVprocgain.doc C:\windows\TEMP\8404003bvprocgain.doc EN/FAD 109 251 R1B Contents 1 Introduction 2 Description of the Method 3 Measurement results 4 Conclusions CONFIDENTIAL REPORT3 (122) Uppgjord (även faktaansvarig om annan) - Prepared (also subject responsible if other)Nr - No. ELN/TA/ Frank Hooijschuur ELN/TG/ Ger Bargerbos ELN/TG/8404003BV/A1 Dokansv/Godk - Doc respons/ApprovedKontr – CheckedDatum - Date RevFile 2001-24-01A18404003BVprocgain.doc C:\windows\TEMP\8404003bvprocgain.doc EN/FAD 109 251 R1B 1 INTRODUCTION FCC has expressed that they preferably would like the processing gain obtained from the DS part to be measured by a (possibly modified) CW jamming margin method. Ericsson has performed such a measurement, and in this paper it is described how this measurement is performed together with the result showing that the PG from the DS part is about 4 dB. Consequently, it is concluded that Ericsson’s radio module has a PG from the DS part which exceeds the required 2 dB, and thus a total PG exceeding 17 dB, so that it indeed fulfils the by FCC imposed requirements. The remaining part of the paper is organized as follows. In Section 2, the CW- jamming method is recapitulated, and all parameter values that have to be determined for an measurement are given. Measurement method and results are given in Section 3. Finally, in Section 4, conclusions are drawn. 2 DESCRIPTION OF THE METHOD Referring to FCC §15.247 (e)(2), the processing gain may be determined as measured using the CW jamming margin method, which, for the sake of completeness, is repeated here: A signal generator is stepped in 50 kHz increments across the passband of the system, recording at each point the generator level required to produce the recommended Bit Error Rate (BER). This level is the jammer level. The output power of the intentional radiator is measured at the same point. The jammer to signal ratio (J/S) is then calculated, discarding the worst 20 % of the J/S data points. The lowest remaining J/S ratio is used to calculate the processing gain, as follows: Gp = S/N + Mj + Lsys, where Gp = the processing gain of the system, S/N = signal to noise ratio required for the chosen BER, Mj =J/S ratio, and Lsys = system losses. Note that total losses in a system, including intentional radiator and receiver, should be assumed to be no more than 2 dB. In Bluetooth, the despreading is accomplished by correlating the received bit stream with the bit pattern of the access code. Then the value of this correlation determines whether or not the access code should be considered as present. For Bluetooth, a “bit error” corresponds to that either the access code is present, but falsely rejected, or that the access code is absent but falsely accepted. The probability of the latter is negligible when compared to the former for any reasonable …
Text truncated - open the document above for the full version.
Im Teelbruch 122 · Lund · Germany
| # | Rule Parts | Frequency Range | Power Output |
|---|---|---|---|
| 1 | 15C | 2.40 GHz - 2.48 GHz | 850.00 µW |

PCMCIA card for Laptop Computer
Equipment Class
TNB - Licensed Non-Broadcast Station Transmitter
Licensed Portable
Equipment Class
PCE - PCS Licensed Transmitter held to ear
Licensed Portable
Equipment Class
PCE - PCS Licensed Transmitter held to ear
Licensed Portable
Equipment Class
PCE - PCS Licensed Transmitter held to ear
Bluetooth Phone Plug
Equipment Class
DSS - Part 15 Spread Spectrum Transmitter