2AGA6-OONTZASLWPortable Bluetooth Speaker

Quick Start Guide Designed and Engineered By TheOontZ.com Portable Bluetooth Speaker OontZ Dual Speaker Model Lastest version of Quick Start Guide available online at www.theoontz.com/support In the Package Lanyard Note: The cable and lanyard are packed below the plastic insert in the box. Slide out the insert to locate them. Quick-Start Guide Portable Bluetooth Speaker OontZ Wireless Dual Stereo Model Designed and Engineered By Micro USB Charging Cable Table of Contents Buttons, Lights and Connectors Attaching the Lanyard Battery Features and Charging the Battery 7XUQLQJ2QDQG2΍ Pair & Connect with Your Device To Play with Non-Bluetooth Devices use a 3.5mm Stereo Audio Cable IPX5 Water Resistance Wireless Hands Free Personal Speakerphone OontZ Dual Speaker - Connect Two OontZ Angle solo Speakers Together Reset Function Contacting Customer Support Safety and Precautions Pages 1 - 3 4 5 - 7 8 9 - 12 13 14 15 16 - 20 21 22 23 - 24 Volume Up Press to increase volume Track Forward Press and Hold Down to go to the next track Volume Down Press to decrease volume Track Back Press and Hold Down to go to the beginning of the track Press and Hold Down twice to go to previous track Buttons Power Play/Pause Button Page 1 Bluetooth Button (Dual Function) Press and Release to Pause/Play Button (Dual Function) Note : Some apps may not support track back, track forward, or play/pause Important : The volume control on your device and the speaker work independently of each other. To play the speaker at the loudest volume, set the volume on your device to maximum and raise the volume on the speaker to maximum. Button (Dual Function) Lights Page 2 Red Light lit when charging: - 6ORZO\ȵDVKLQJ5HGbattery is charging - 6ROLG5HG battery is fully charged Blue Light lit when speaker is on: - )ODVKLQJ%OXHspeaker is in pairing mode - Solid Blue speaker is connected Lit White/Orange when the speaker is the second speaker connected in OontZ Dual Speaker - With a second OontZ Angle solo speaker (sold separately) you can wirelessly connect both speakers together to play with OontZ Dual Speaker. - For OontZ Dual Speaker instructions please see page 17. Connectors Page 3 AUX IN JackMicro USB &KDUJLQJ&RQQHFWRU 5XEEHU)ODS - covers connectors - pull gently from the top to access FRQQHFWRUVLWLVDVQXJȴWWR provide water resistance Built-in Mic for Speakerphone 1RWH7KHUXEEHUȵDSQHHGVWREHFORVHG WRNHHSWKHVSHDNHUZDWHUUHVLVWDQW Attaching the Lanyard Page 4 - Slide the smaller lanyard loop through one of the lanyard attachment holes at the top of the speaker - Slide the larger lanyard loop through the smaller lanyard loop that has passed though the other attachment hole - The lanyard is not for use by children under 6 years of age. Small parts can present a choking hazard. - Pull the larger lanyard loop completely through the smaller lanyard loop to fasten the lanyard to the speaker Battery Features Page 5 Music Play Time Up to 12 hours on a full charge, at 2/3 volume. Louder volumes will reduce the battery play time. - The rechargeable battery comes with a partial charge and the speaker is ready to play. - For maximum playtime, fully charge the battery. - You can play while charging. /RZ&KDUJH5HPDLQLQJ - When the battery charge has less than 15% remaining the Red Light will begin ȵDVKLQJUDSLGO\ - The volume will decrease to preserve the remaining battery charge. *Exception: when connected to certain devices, including the Amazon Echo Dot or Amazon Echo, the Power Saving Feature is disabled and the speaker will remain on until \RXWXUQWKHSRZHUR΍ 3RZHU6DYLQJ)HDWXUH - When playing from battery power the 2RQW=$QJOHVRORZLOOWXUQR΍DIWHU minutes of not playing audio to conserve the battery charge. * - When plugged into a charging source the OontZ Angle solo will remain on XQWLO\RXWXUQWKHSRZHUR΍ - You can continue to keep the speaker plugged into a charging source even when it is fully charged, keeping the speaker turned on and available Charging the Battery Page 6 - Insert the small end of the Micro USB Charging Cable into the Micro USB Charging Connector as shown. - Insert the large end of the Micro USB Charging cable into either a USB wall charger for a Smartphone or iPhone, or a USB port on your laptop/computer to charge the battery (see illustrations on page 7). Charging Time: - Up to 4 hours to fully charge a low battery. Red Light lit when charging: - 6ORZO\ȵDVKLQJ5HG battery is charging - 6ROLG5HG battery is fully charged Charging the Battery (continued) Page 7 Insert the large end of the Micro USB Charging Cable into either a USB wall charger for a Smartphone or iPhone (a USB wall charger* that is 5V 1.0A maximum) or a USB port on your laptop/computer to charge the OontZ Angle solo rechargeable battery. * Only use a USB wall charger that is UL listed. A USB wall charger will have the logo printed on it. 7XUQLQJ2QDQG2΍ Page 8 Blue Light will turn on Red Light will turn on for 2 seconds %OXH/LJKWZLOOWXUQR΍ )ODVKLQJ%OXH The speaker is in pairing mode - Solid Blue Your device has connected with the OontZ Angle solo and is ready to play Press and Release the Power Button Press and Hold Down the Power Button for 2 Seconds Turn ON Turn OFF Pair & Connect with Your Device -- Step 1 Page 9 7XUQ21\RXU2RQW=$QJOHVROR )ODVKLQJ%OXH/LJKW - The OontZ Angle solo is ready to pair and connect. 6ROLG%OXH/LJKW - Your device has connected to the OontZ Angle solo and is ready to play. - The OontZ Angle solo allows the last device it was connected with to automatically reconnect with the speaker, each time you turn the speaker on and that device is within range.* 7KH2RQW=$QJOHVRORFDQEHFRQQHFWHGWRRQHGHYLFHDWDWLPH 7RSDLUDQGFRQQHFWWRDGL΍HUHQWGHYLFH\RXQHHGWRȴUVWGLVFRQQHFWWKHFXUUHQWO\SDLUHGdevice. - To disconnect the current device, press and hold down the %OXHWRRWKEXWWRQ for 3 seconds. - The %OXH/LJKWwill begin ȵDVKLQJand the OontZ Angle solo is …

Text truncated - open the document above for the full version.

Reference N Waltek Tes http://www EXHIBI EUT View 1 EUT View 2 No.: WTX20X sting Group w.semtest.co T 2 - EUT 1 2 X06037898W (Shenzhen) m.cn T EXTER W-1 Co., Ltd. RNAL PH HOTOGR APHS Reference N Waltek Tes http://www EUT View 3 EUT View 4 No.: WTX20X sting Group w.semtest.co 3 4 X06037898W (Shenzhen) m.cn W-1 Co., Ltd. Reference N Waltek Tes http://www EUT View 5 EUT View 6 No.: WTX20X sting Group w.semtest.co 5 6 X06037898W (Shenzhen) m.cn W-1 Co., Ltd. Reference N Waltek Tes http://www EUT View 7 No.: WTX20X sting Group w.semtest.co 7 X06037898W (Shenzhen) m.cn W-1 Co., Ltd.

Reference N Waltek Tes http://www EXHIBI Proposed Specificatio n it is visible durable to r expected lif e Proposed No.: WTX20X sting Group w.semtest.co T 1 - PRO FCC ID La ns: The label or easily acc emain fully l etime. Label Loca X06037898W (Shenzhen) m.cn ODUCT L abel Forma FC shall be secu cessible to th legible and in ation on EU W-1 Co., Ltd. LABELIN at CC ID: 2A urely affixed t he user, and ntact on the UT FCC NG AGA6-OON to a permane shall not be device in al l ID Label Lo NTZASLW ently attached readily detac l normal cond cation d part of the d chable. The l ditions of use device, in a lo label shall be e throughout ocation where e sufficiently t the device’s e y s

Reference N Waltek Tes http://www EXHIBI EUT Housi n Solder Boa r No.: WTX20X sting Group w.semtest.co T 3 - EUT ng and Boar rd-Compone X06037898W (Shenzhen) m.cn T INTER rd View 1 ent View 1 W-1 Co., Ltd. NAL PHO OTOGRA APHS Reference N Waltek Tes http://www Solder Boa r Solder Boa r No.: WTX20X sting Group w.semtest.co rd-Compone rd-Compone Bluetooth X06037898W (Shenzhen) m.cn ent View 2 ent View 3 Antenna W-1 Co., Ltd.

RF Exposure Requirements Product Description: Portable Bluetooth Speaker Model No.: OontZ Angle solo FCC ID: 2AGA6-OONTZASLW According to the KDB 447498 D01 v06 section 4.3.1, for 100 MHz to 6 GHz and test separation distances ≤ 50 mm, the 1-g and 10-g SAR test exclusion thresholds are determined by the following: [(max. power of channel, including tune-up tolerance, mW)/(min. test separation distance, mm)] · [√f(GHz)] ≤ 3.0 for 1-g SAR and ≤ 7.5 for 10-g extremity SAR, where - f(GHz) is the RF channel transmit frequency in GHz - Power and distance are rounded to the nearest mW and mm before calculation17 - The result is rounded to one decimal place for comparison Calculation Result: Tx frequency range: 2402-2480MHz Min. test separation distance: 5mm Maximum Conducted Output Power: 6.07dBm Tune-Up output power: 7dBm RF channel transmit frequency: 2480MHz Result: 1.6 Limit: 3.0 The exclusion thresholds is 1.6 < 3, so the transmitter complies with the RF exposure requirements and the SAR is not required.

Waltek Testing Group (Shenzhen) Co., Ltd. http://www.semtest.com.cn Page 1 of 51 TEST REPORT Reference No. .................... : WTX20X06037898W-1 FCC ID ................................ : 2AGA6-OONTZASLW Applicant ........................... : Shenzhen AngSi Technology Co., Ltd. Address ............................. : 6/F, Block B, Ding Xin Science Park, Hong Lang North No.2 Road, Bao An District, ShenZhen PRC Product Name ................... : Portable Bluetooth Speaker Test Model. ........................ : OontZ Angle solo Standards .......................... : FCC Part 15.247 Date of Receipt sample .... : Jun.17, 2020 Date of Test........................ : Jun.17, 2020 to Jul.06, 2020 Date of Issue ..................... : Jul.06, 2020 Test Result ......................... : Pass Remarks: The results shown in this test report refer only to the sample(s) tested, this test report cannot be reproduced, except in full, without prior written permission of the company. The report would be invalid without specific stamp of test institute and the signatures of compiler and approver. Prepared By: Waltek Testing Group (Shenzhen) Co., Ltd. Address: 1/F., Room 101, Building 1, Hongwei Industrial Park, Liuxian 2nd Road, Block 70 Bao'an District, Shenzhen, Guangdong, China Tel.: +86-755-33663308 Fax.: +86-755-33663309 Tested by: Reviewed By: Approved & Authorized By: Mike Shi / Project Engineer Lion Cai / RF Manager Silin Chen / Manager Reference No.: WTX20X06037898W-1 Page 2 of 51 Waltek Testing Group (Shenzhen) Co., Ltd. http://www.semtest.com.cn TABLE OF CONTENTS 1. GENERAL INFORMATION ................................................................................................................................... 5 1.1 PRODUCT DESCRIPTION FOR EQUIPMENT UNDER TEST (EUT) ............................................................................... 5 1.2 TEST STANDARDS ................................................................................................................................................... 6 1.3 TEST METHODOLOGY ............................................................................................................................................. 6 1.4 TEST FACILITY ....................................................................................................................................................... 6 1.5 EUT SETUP AND TEST MODE ................................................................................................................................. 7 1.6 MEASUREMENT UNCERTAINTY .............................................................................................................................. 8 1.7 TEST EQUIPMENT LIST AND DETAILS ..................................................................................................................... 9 2. SUMMARY OF TEST RESULTS ......................................................................................................................... 11 3. RF EXPOSURE ....................................................................................................................................................... 12 3.1 STANDARD APPLICABLE ....................................................................................................................................... 12 3.2 TEST RESULT........................................................................................................................................................ 12 4. ANTENNA REQUIREMENT ................................................................................................................................ 13 4.1 STANDARD APPLICABLE ....................................................................................................................................... 13 4.2 EVALUATION INFORMATION ................................................................................................................................ 13 5. FREQUENCY HOPPING SYSTEM REQUIREMENTS ................................................................................... 14 5.1 STANDARD APPLICABLE ....................................................................................................................................... 14 5.2 FREQUENCY HOPPING SYSTEM............................................................................................................................. 14 5.3 EUT PSEUDORANDOM FREQUENCY HOPPING SEQUENCE .................................................................................... 15 6. QUANTITY OF HOPPING CHANNELS AND CHANNEL SEPARATION ................................................... 16 6.1 STANDARD APPLICABLE ....................................................................................................................................... 16 6.2 TEST SETUP BLOCK DIAGRAM ............................................................................................................................. 16 6.3 TEST PROCEDURE ................................................................................................................................................. 16 6.4 SUMMARY OF TEST RESULTS/PLOTS .................................................................................................................... 17 7. DWELL TIME OF HOPPING CHANNEL .......................................................................................................... 20 7.1 STANDARD APPLICABLE ....................................................................................................................................... 20 7.2 TEST SETUP BLOCK DIAGRAM ............................................................................................................................. 20 7.3 TEST PROCEDURE ................................................................................................................................................. 20 7.4 SUMMARY OF TEST RESULTS/PLOTS .......…

Text truncated - open the document above for the full version.

Reference N Waltek Tes http://www EXHIBI Conducted Radiation E No.: WTX20X sting Group w.semtest.co T 4 - TES Emission Te Emission Tes X06037898W (Shenzhen) m.cn ST SETUP est Setup st Setup (Belo W-1 Co., Ltd. P PHOTO ow 30MHz) OGRAPH HS Reference N Waltek Tes http://www Radiation E Radiation E No.: WTX20X sting Group w.semtest.co Emission Tes Emission Tes X06037898W (Shenzhen) m.cn st Setup (30M st Setup (1GH W-1 Co., Ltd. MHz to 1GHz Hz to 18GHz z) z) Reference N Waltek Tes http://www Radiation E No.: WTX20X sting Group w.semtest.co Emission Tes X06037898W (Shenzhen) m.cn st Setup (Abo W-1 Co., Ltd. ove 18GHz)