UZ5-BHM2100001Bluetooth Mono Headset

The Mini BT headset is a wireless headset for mobile phones with Bluetooth technology. Bluetooth technology is a standard for wireless data communication over a short distance. Headsets and Bluetooth compatible mobile phones can be wirelessly connected up to a distance of 10 meters. This product is a Bluetooth-compatible headset that fulfills the conditions as required by Bluetooth 1.2 protocol. Two profiles are supported: devices equipped with headset and hands-free profiles. Therefore, the headset functions with all suitable Bluetooth devices that support the headset and/or hands-free profiles. Bluetooth Headset Description 1. Microphone 2. S1 button 3. S2 button 4. S3 button 5. Charging terminal 6. Ear band 7. Earphones/speakers 8. Blue LED indicator 9. Red LED indicator BHM-110 BHM-121 Before using the headset for the first time, need to charge the headset with the supplied power supply unit for at least 2 hours. ‡3OXJWKHFKDUJHULQWRWKHPDLQVVRFNHWDQGFRQQHFWLWWRWKHVRFNHWRQWKH headset. ‡7KHLQWHJUDWHG/('OLJKWVUHGGXULQJWKHFKDUJLQJSURFHVVDQGJRHVRIIZKHQWKH EDWWHU\LVIXOO\FKDUJHG7KHEOXH/('ZLOOEHRQDWWKHZKLOH ‡3OHDVHQRWHWKDWLIWKHKHDGVHWKDVQRWEHHQXVHGIRUDQH[WHQGHGSHULRGRIWLPH RUWKHYROWDJHRIWKHKHDGVHWLVWRRORZWKHUHG/('ZLOOEHRQDIWHUDVHFRQG GHOD\+RZHYHUWKHEOXH/('ZRXOGEHRQLPPHGLDWHO\ ‡7KHUHG/('IODVKHVWRLQGLFDWH³ORZEDWWHU\ ́&KDUJHWKHEDWWHU\DQGRUWKH headset as described. Charging the headset Functions of the S1, S2, and S3 buttons: S1: ‡2QRIIVZLWFK ‡$FFHSWLQJFDOOV ‡3DLULQJ ‡(QGLQJFDOOV ‡9RLFHGLDOLQJ ‡5HGLDO ‡5HMHFWLQJFDOOV S2: ‡9ROXPHGRZQ S3: ‡9ROXPHXS S2+S3: ‡0XWLQJ Switching the headset on/off Adjusting the headset to your mobile phone (pairing) You must introduce both components to enable the headset to communicate with your telephone. This process is known as pairing or coupling and is the basis for using the Bluetooth headset. Pairing only has to be carried out once before the headset is commissioned for the first time. Ensure that the headset is fully charged and the power supply is not plugged into the headset. Prepare your telephone for the pairing process. Follow the instructions in the operating manual of your mobile phone to switch your telephone to Bluetooth mode and initiate and perform the coupling procedure. ‡(QVXUHWKDWWKHKHDGVHWLVVZLWFKHGRII ‡3UHVVWKH6EXWWRQRQWKHKHDGVHWIRUVHFRQGVXQWLOWKH/('VWDUWVIODVKLQJ red and blue alternately. The headset is now in pairing mode. Please note: The headset maintains pairing mode for 5 minute. After this time, it must be started again as described. ‡6WDUWSDLULQJZLWK\RXUPRELOHSKRQHDVGHVFULEHGLQWKHLQVWUXFWLRQPDQXDOIRU your phone. Follow the instructions on your phone‘s display. ‡<RXUWHOHSKRQHVHDUFKHVIRUFRUUHVSRQGLQJGHYLFHVLQWKH%OXHWRRWKHQYLURQPHQW ‡:KHQ\RXUPRELOHSKRQHILQGVWKHKHDGVHW³%+0 ́RU³%+0 ́ZLOOEH shown on the phone‘s display. ‡6HOHFWWKHKHDGVHWDQGIROORZWKHUHPDLQLQJLQVWUXFWLRQVLQWKHSKRQHRULQWKH operating instructions of the phone. 3 ‡3UHVVDQGKROGWKH³6 ́EXWWRQIRUVHFRQGVWRVZLWFKRQWKHKHDGVHW7KHEOXH /('RQWKHKHDGVHWWKHQIODVKHV ‡3UHVVWKH³6 ́EXWWRQIRUVHFRQGVWRGHDFWLYDWHWKHKHDGVHW7KHUHG/('RQ the headset flashes red briefly, and the headset shuts off. Use/Call management Accepting, ending, and rejecting calls Making calls 4 ‡,I\RXDUHDVNHGIRUWKHSDVVNH\RU3,1FRQILUPWKLVE\HQWHULQJ ‡3DLULQJLVQRZFRPSOHWH7KHUHG/('JRHVRXW7KHEOXH/('QRZIODVKHV UHJXODUO\WKXVLQGLFDWLQJWKDWLWLVUHDG\IRURSHUDWLRQ VWDQGE\ 7KHKHDGVHW LVQRZUHDG\IRURSHUDWLRQDQGFDQEHXVHG 3OHDVHQRWHWKDWQRWDOOPRELOHSKRQHVVXSSRUWDOOWKHFDOOPDQDJHPHQW IXQFWLRQV7KLVGHSHQGVRQZKHWKHUWKHPRELOHSKRQHVXSSRUWVWKHKDQGVIUHH SURILOH³KHDGVHW ́DQGRU³KDQGVIUHH ́)RUPRUHLQIRUPDWLRQSOHDVHUHIHUWRWKH RSHUDWLQJLQVWUXFWLRQVRI\RXUPRELOHSKRQH ‡<RXFDQDQVZHULQFRPLQJFDOOVXVLQJWKHKHDGVHW$QLQFRPLQJFDOOLV LQGLFDWHGE\WKHEOXH/('IODVKLQJTXLFNO\DVZHOODVE\DQDXGLEOHVLJQDOLQ WKHKHDGVHW ‡3UHVVWKH6EXWWRQWRDFFHSWWKHFDOO ‡3UHVVWKH6EXWWRQDJDLQWRHQGWKHFDOO ‡7RUHMHFWLQFRPLQJFDOOVSUHVVWKH6EXWWRQIRUVHFRQGV (QVXUHWKDW\RXUKHDGVHWLVFRQQHFWHGWRWKHWHOHSKRQH &DOOVDUHPDGHDVXVXDOZLWKWKHH[FHSWLRQWKDWWKHKHDGVHWLVXVHGWRPDNH WKHFDOO Making calls using voice dialing Waiting calls Switching off the sound of the microphone Press the S1 button to accept a waiting call during another call. During a call, the microphone on the headset can be set to mute. This can be used, for example, to hold confidential conversations with another person or make inquiries that the person on the phone cannot hear. To do so, press the S2 and S3 buttons simultaneously – the microphone will be deactivated. To switch the sound of the microphone back on, press the S2 and S3 buttons at the same time again - the microphone will be re-activated. To make calls using voice dialing, the corresponding voice profiles must be set up/stored in your phone. Your telephone must also support this function in Bluetooth mode (hands-free profile only). For more information, please refer to the operating instructions of your mobile phone. Voice dialing using the headset operates in the same manner as if you were making a call using the phone. The only difference is that voice dialing is activated using the headset, not the phone. ‡3UHVVWKH6EXWWRQ ‡$VKRUWWRQHLQGLFDWHVWKDWYRLFHGLDOLQJKDVEHHQDFWLYDWHG ‡6D\WKHFRUUHFWQDPHRUWKHYRLFHSURILOHRIWKHSHUVRQ\RXZLVKWRFDOO ‡7KHFDOOZLOOEHPDGH ‡3UHVV6DJDLQWRFDQFHOYRLFHGLDOLQJ 5 Please note : Volume control Precautionary measures and caring for your Bluetooth headset 6 With some mobile phones, the connection between the telephone and the headset is automatically disconnected after a c…

Text truncated - open the document above for the full version.

The contact window is Jack Li, I have modified Grantee code information. The revised 731 Form has been uploaded to database. The revised operational description has been uploaded to database. The revised schematics has been uploaded to database. The revised Part 15C report with clear test plots has been uploaded to database. The revised test report with correct test procedures has been uploaded to database. Sorry to make a typed error, 10KHz should be correct. The revised user manual has been uploaded to database.

Statement in user manual:

Report No.: GLEMR071103574RFT Page: 1 of 47 FCC ID: UZ5-BHM2100001 Authorized Signature: Stephen Guo Manager The manufacturer should ensure that all products in series production are in conformity with the product sample detailed in this report. If the product in this report is used in any configuration other than that detailed in the report, the manufacturer must ensure the new system complies with all relevant standards. The report must not be used by the client to claim product certification, approval, or endorsement by NVLAP, NIST, or any agency of the federal government. All test results in this report can be traceable to National or International Standards. This document is issued by the Company under its General Conditions of Service printed overleaf or available on request and accessible at http://www.sgs.com/terms_and_conditions.htm. Attention is drawn to the limitation of liability, indemnification and jurisdiction issues defined therein. Any holder of this document is advised that information contained hereon reflects the Company’s findings at the time of its intervention only and within the limits of Client’s instructions, if any. The Company’s sole responsibility is to its Client and this document does not exonerate parties to a transaction from exercising all their rights and obligations under the transaction documents. Any unauthorized alteration, forgery or falsification of the content o r appearance of this document is unlawful and offenders may be prosecuted to the fullest extent of the law.” Unless otherwise stated the results shown in this test report refer only to the sample(s) tested. This document cannot be reproduced except in full, without prior approval of the Company. SGS-CSTC Standards Technical Services Ltd. No.198 Kezhu Road, Science Town Economic& Technology Development District Guangzhou, China 510663Telephone: Telephone: +86 (0) 20 82155555 Fax: +86 (0) 20 82075059 Email: [email protected] FEDERAL COMMUNICATIONS COMMISSION Registration number: 282399 TEST REPORT Application No. : GLEMR071103574RF Applicant: Phoenix International Co., Ltd FCC ID: UZ5-BHM2100001 Fundamental Carrier Frequency : 2.402GHz to 2.480GHz Equipment Under Test (EUT): Name: Bluetooth Mono Headset Model: BHM-110, BHM-121, BHM-123, BHM-125, MiniStar II, 87552♣ ♣ Please refer to section 2 of this report which indicates which item was actually tested and which were electrically identical. Serial No.: Not supplied by client Standards: FCC PART 15, SUBPART C: 2007 (Section 15.247) Date of Receipt: Nov 26, 2007 Date of Test: Nov 29, 2007 – Dec 07, 2007 Date of Issue: Dec 10, 2007 Test Result : PASS * * In the configuration tested, the EUT detailed in this report complied with the standards specified above. Please refer to section 2 of this report for further detail. SGS-CSTC Standards Technical Services Ltd. Report No.: GLEMR071103574RFT Page: 2 of 47 FCC ID: UZ5-BHM2100001 2 Test Summary Remark: ♣ Model: BHM-110, BHM-121, BHM-123, BHM-125, MiniStar II, 87552 For only one model was tested, according to the confirmation from the applicant. Since the applicant declared electrical circuit design, layout, components used and internal wiring were identical for the above items, with only difference being the model no. Test Test Requirement Standard Paragraph Result Antenna Requirement FCC PART 15 :2007Section 15.247 (c) PASS Occupied Bandwidth FCC PART 15 :2007Section 15.247 (a1) PASS Carrier Frequencies Separated FCC PART 15 :2007Section 15.247(a)(1) PASS Hopping Channel Number FCC PART 15 :2007Section 15.247(a)(1)(iii) PASS Dwell Time FCC PART 15 :2007Section 15.247(a)(1)(iii) PASS Pseudorandom Frequency Hopping Sequence FCC PART 15 :2007 Section 15.247(a)(1) PASS Maximum Peak Output Power FCC PART 15 :2007Section 15.247(b)(1) PASS RF Exposure Compliance Requirement FCC PART 15 :2007 15.247(b)(4)& TCB Exclusion List (7 July 2002) PASS Conducted Emission FCC PART 15 :2007Section 15.207 PASS Conducted Spurious Emission (30MHz to 25GHz) FCC PART 15 :2007 Section 15.209 &15.247(d) PASS Radiated Spurious Emission (30MHz to 25GHz) FCC PART 15 :2007 Section 15.209 &15.247(d) PASS Radiated Emission FCC PART 15 :200 Section 15.209 PASS Band Edges Measurement FCC PART 15 :2007 Section 15.247 (d) &15.205 PASS SGS-CSTC Standards Technical Services Ltd. Report No.: GLEMR071103574RFT Page: 3 of 47 FCC ID: UZ5-BHM2100001 3 Contents Page 1 COVER PAGE ...........................................................................................................................................1 2 TEST SUMMARY ....................................................................................................................................... 2 3 CONTENTS ................................................................................................................................................ 3 4 GENERAL INFORMATION ........................................................................................................................ 4 4.1 CLIENT INFORMATION.............................................................................................................................. 4 4.2 GENERAL DESCRIPTION OF E.U.T. .......................................................................................................... 4 4.3 DESCRIPTION OF SUPPORT UNITS........................................................................................................... 4 4.4 STANDARDS APPLICABLE FOR TESTING.................................................................................................... 4 4.5 TEST LOCATION...................................................................................................................................... 4 4.6 OTHER INFORMATION REQUESTED BY THE CUSTOMER............................................................................. 4 4.7 TEST FACILITY..........................................................................................................…

Text truncated - open the document above for the full version.

1.1 Radiated Spurious Emission Test Setup 1.2 Conducted Emission Test Setup